SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5Q4X2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5Q4X2
Domain Number 1 Region: 537-566,665-742
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000922
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5Q4X2
Sequence length 761
Comment (tr|W5Q4X2|W5Q4X2_SHEEP) Solute carrier family 26 member 6 {ECO:0000313|Ensembl:ENSOARP00000017762} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=SLC26A6 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MGLSEAPGERDTQALLSRTQAMELRRRDYRVERPLLNQEQLEELGSRSPAPVTLQWRTWF
RCSRARAQALLLQYLPVLAWLPQYSVRDWLLGDLLSGLSVAIMQLPQGLAYALLAGLPPV
YGLYSSFYPVFVYFLFGTSRHISVGTFAVMSVMVGSVMESLAPDDAFLLGLNSTVNVTAR
DDTRVQLASTLSVLVGLFQVGLGMVHFGFVVTYLSEPLVRAYTTAASVHVFISQLKYVFG
LHLSSRSGPLSLIYTVLEVCWKLPQTVVGTVITAIVAGVVLVKLLNEKLRRHLPMPLPGE
LLTLIGATGISYGVGLQQAFGVDIVGKIPAGLVPPKAPHPQLFAKLLGNAFAIAVVGFAI
AISLGKIFALRHGYRVYSNQAWTPRTTSDVCSLLTPRSAVSCSMSRSLVQESTGGNTQVA
GAVSSFFILIIIVKLGELFQDLPKAVLAAVVIVNLKGMVMQFTDVFSLWKANRMDLLIWV
VTFVATILLNLDLGLAVAVVFSLMLVVVRTQMPHYSVLGQMPDTDIYRDLAEYSGAREVP
GVKVFRSSATVYFANAELYSDSLKQRCGVDVDYLLSQKKKLLRKQELKLKRLQKENKLPK
QAAASKGTSISINVNTTVVDIESNNDVEGSKAKEASAGTELEETGAWAPEDAKASDMSSL
KALGLPQPDFHTLILDLSSFSFVDTVCLKSLKNIFRDFREIEVEVYMAACHAPVIKQLED
GHFFDASITKQHLFASVHDAVLFALQQRRSSPVDPVLVTKL
Download sequence
Identical sequences W5Q4X2
XP_011955481.1.66739 ENSOARP00000017762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]