SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5Q5Q4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5Q5Q4
Domain Number 1 Region: 173-420
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.97e-35
Family WD40-repeat 0.00031
Further Details:      
 
Domain Number 2 Region: 39-102
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000068
Family F-box domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W5Q5Q4
Sequence length 432
Comment (tr|W5Q5Q4|W5Q5Q4_SHEEP) F-box and WD repeat domain containing 4 {ECO:0000313|Ensembl:ENSOARP00000018044} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=FBXW4 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
GRPRGRSWVARAAWGPPGTVGPASGAGNVAAGPSGEPACRPAAGPALLCLPEELLLLIFS
YLDMQALGRLAQVCRWLRRFTSCDLLWRRIARASPPPPRPRAGPRPGMASVPVKERVKVS
QNWRLGRCREGILLKWRCSQMPWMQLEGDSLYISQANFILAYQFRPDGASLNRRPLGVFA
GHDEDVCHFVLANSHIISAGGDGKIGIHKIHSTFTVKYSAHVQEVNCVDCKGGIIVSGSR
DRTAKVWPLASGRLGQCLHTIQTEDRVWSIAISPLLSSFVTGTACCGHFSPLRIWDLNSG
QLMTHLGSDFPPGAGVLDVMYESPSTLLSCGYDTYVRYWDLRASARKCVMEWEEPHDSTL
YCLQTDGNHLLATGSSYYGVVRLWDRRQRACLHAFPLTSTPLSSPVYCLRFTTRHLYAAL
SYNLRVLDFQNP
Download sequence
Identical sequences W5Q5Q4
ENSOARP00000018044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]