SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5Q5T3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5Q5T3
Domain Number 1 Region: 119-339
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 8.86e-50
Family Reprolysin-like 0.0027
Further Details:      
 
Domain Number 2 Region: 884-940
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000157
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 3 Region: 712-773
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000759
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 4 Region: 777-833
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000772
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 5 Region: 433-482
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000123
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 835-879
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000484
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5Q5T3
Sequence length 1004
Comment (tr|W5Q5T3|W5Q5T3_SHEEP) ADAM metallopeptidase with thrombospondin type 1 motif 19 {ECO:0000313|Ensembl:ENSOARP00000018073} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=ADAMTS19 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MRRSSAPPPPAPPDAACFYTGAVLRQPGSLASFSTCGGGLMGFIQLNEDFIFIEPLNDTV
AITGHPHRVYRRKRSMEEKVTEKSVPHSHYCGVISDKGRPKSKKITESGRGKRYSYKLPQ
EYNIETVVVADPAMVSYHGADAARRFILTILNMVFNLFQHKSLGVQVNLRVIKLILLHET
PADLYIGHHGEKMLESFCKWQHEEFGKKNDIHLEMSTSWGEDMTSVDAAILITRKDFCVH
KDEPCDTVGIAYLSGMCSEKRKCIIAEDNGLNLAFTIAHEMGHNMGINHDNDHPSCADGL
HIMSGEWIKGQNLGDVSWSRCSKEDLERFLRSKASNCLLQTNPHSVNSVMVPSKLPEMTY
TADEQCQILFGPLASFCQEMQHVICTGLWCKVEGEKECKTKLDPPMDGTDCDIGKWCKAG
ECTSRTAAPGLAAGEWSTWSPCSRTCSSGISSRERKCPGLGSEARDCNGPRKQYRICENP
PCPAGLPGFRDWQCQAYSVRTSYPKHVLQWHAVMDEEKPCALFCSPVGKEQPILLSEKVL
DGTSCGYQGLDVCANGRCQKVGCDGLLGSLAREDHCGVCNGNGKSCKIIKGDFNHTRGAG
YVEVLVIPAGARRIKVVEEKPAHSYLALRDTEKQSINSDWKIEHSGAFNIAGTTVHYVRR
GLWEKISAKGPTTTPLHLLVLLFQDQNYGLHYEYTIPSDPPPENQSSKAPEPLFMWTHTG
WEDCDATCGGGERKTTVSCTKIMNKNISIVDNKKCKYLTKPEPQIRKCNEQPCQTRWMMT
EWTPCSRTCGKGMQSRQVACTQQLSNGTLTRARERDCTGPKPASAQRCEGQDCMTVWEAG
VWSECSVKCGKGVRHRTVRCTNPRKKCVLSTRPREAEDCEDYSKCYVWRMGDWSKCSITC
GKGMQSRVIQCMHKITGRHGNECFSSEKPAAYRPCHLQPCNEKINVNTITSPRLAALTFK
CLGDQWPVYCRVIREKNLCQDMRWYQRCCETCRDFYAQKLQQKS
Download sequence
Identical sequences W5Q5T3
ENSOARP00000018073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]