SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5Q5V6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5Q5V6
Domain Number 1 Region: 155-546
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.55e-83
Family L-arabinose binding protein-like 0.0006
Further Details:      
 
Domain Number 2 Region: 74-130
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000195
Family Complement control module/SCR domain 0.0000354
Further Details:      
 
Domain Number 3 Region: 27-74
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000361
Family Complement control module/SCR domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W5Q5V6
Sequence length 931
Comment (tr|W5Q5V6|W5Q5V6_SHEEP) Gamma-aminobutyric acid type B receptor subunit 1 {ECO:0000313|Ensembl:ENSOARP00000018096} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=GABBR1 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
GCQIIHPPWEGGIRYRGLTRDQVKAINFLPVDYEIEYVCRGEREVVGPKVRKCLANGSWT
DMDTPSRCVRICSKSYLTLENGKVFLTGGDLPALDGARVDFRCDPDFHLVGSSRSICSQG
QWSTPKPHCQVNRTPHSGKGAPPSPAPAPSRSPRTXACQPAVGMALEDVNSRRDILPDYE
LKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYGSS
SPALSNRQRFPTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERV
KEAGIEITFRQSFFSDPAVPVKNLKRQDARIIVGLFYETEARKVFCEVYKERLFGKKYVW
FLIGWYADNWFKIYDPSINCTVDEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVEKL
TKRLKRHPEETGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQTITDQIY
RAMNSSSFEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIG
GSPPADQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLN
NLTAVGCSLALAAVFPLGLDGYHIGRSQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHT
VFTKKEEKKEWRKTLEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDI
DVSILPQLEHCSSKKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIY
NVAVLCLITAPVTMILSSQQDAAFAFASLAIVFSSYITLVVLFVPKMRRLITRGEWQSEA
QDTMKTGSSTNNNEEEKSRLLEKENRELEKIIAEKEERVSELRHQLQSRQQLRSRRHPPT
PPDPSGGLPRGPPEPPDRLSCDGSRVHLLYK
Download sequence
Identical sequences W5Q5V6
ENSOARP00000018096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]