SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5Q623 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5Q623
Domain Number 1 Region: 804-888
Classification Level Classification E-value
Superfamily DEATH domain 5.36e-24
Family DEATH domain, DD 0.0000516
Further Details:      
 
Domain Number 2 Region: 131-223
Classification Level Classification E-value
Superfamily Immunoglobulin 3.05e-16
Family I set domains 0.024
Further Details:      
 
Domain Number 3 Region: 222-273
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000392
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 4 Region: 276-330
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000209
Family TSP-1 type 1 repeat 0.00076
Further Details:      
 
Domain Number 5 Region: 25-127
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000163
Family I set domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5Q623
Sequence length 893
Comment (tr|W5Q623|W5Q623_SHEEP) Unc-5 netrin receptor C {ECO:0000313|Ensembl:ENSOARP00000018163} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=UNC5C OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MSWQYEDFFHELPETFPSDPPEPLPHFLIEPEEAYIVKNKPVNLYCKASPATQIYFKCNS
EWVHQKDHIVDERVDETSGLIVREVSIEISRQQVEELFGPEDYWCQCVAWSSAGTTKSRK
AYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPVEDRNFY
ITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVYVNGGWSTWTEWSVCNSRCG
RGYQKRTRTCTNPAPLNGGAFCEGQSVQKIACTTLCPVDGRWTSWSKWSTCGTECTHWRR
RECTAPAPKNGGKDCDGLVLQSKNCTDGLCMQTAPDSDDVALYVGIVIAVIVCLAISVVV
ALFVYRKNHRDFESDIIDSSALNGGFQPVNIKAARQDLLAVPPDLTSAAAMYRGPVYALH
DVSDKIPMTNSPILDPLPNLKIKVYNTSGAVTPQDDLSEFASKLSPQMTQSLLENEALNL
KNQSLARQTDPSCTAFGTFNSLGGHLVIPNAGVSLLIPAGAIPQGRVYEMYVTVHRKENM
RPPMEDSQTLLTPVVSCGPPGALLTRPVILTMHHCADPSTEDWKIQLKNQAAQGQWEDVV
VVGEENFTTPCYIQLDAEACHLLSENLGTYALVGQSTTKAAAKRLKLAIFGPLCCSSLEY
SLRVYCLDDTQDALKEVLQLERQMGGQLLEEPKALHFKGSTHNLRLSIHDIAHSLWKSKL
LAKYQEIPFYHIWSGSQRNLHCTFTLERFSLNTVELVCKLCVRQVEGEGQIFQLNCTVSE
EPTGMDLPLLDPASTITTMTGPSAFSIPPPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDR
YLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAEGQY
Download sequence
Identical sequences W5Q623
ENSOARP00000018163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]