SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5Q674 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5Q674
Domain Number 1 Region: 69-184
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000706
Family Spermadhesin, CUB domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5Q674
Sequence length 330
Comment (tr|W5Q674|W5Q674_SHEEP) Corticotropin-releasing hormone-binding protein {ECO:0000256|PIRNR:PIRNR009279} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=CRHBP OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MAPTLKLQCHFILVCLLALRGESRYLEPAARIPIAKGRRVGRGGAPGRDGVTLREPGAEA
GRRGSGCVDMLSLQGQFTFTADRPQLHCATFFIAEPEEFITIHYDLVSIDCLRGDILGKV
FDGWILKGEKFPSSQDHPLPTTERYVDFCDSGLSRRSIRSSQNVAMIFFRVHEPGNGFTI
TVKTEPNLFPCNIISQTPNGRFTLVMPHQHRNCSFSIIYPVAIKISDLTLGHLNGLQLKK
SSAGCGGIGDFVELLGGTGLDPSKMLLLADLCYPLRGPAQMKVGCDHTVLRMVSSGKHIN
RVTFEYRQLEPYELENPNGNSIQEFCLSTL
Download sequence
Identical sequences W5Q674
ENSOARP00000018214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]