SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5Q9T5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5Q9T5
Domain Number 1 Region: 924-1105
Classification Level Classification E-value
Superfamily Fibronectin type III 3.23e-20
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 2 Region: 304-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000786
Family EGF-type module 0.004
Further Details:      
 
Domain Number 3 Region: 698-824
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000204
Family Growth factor receptor domain 0.0095
Further Details:      
 
Domain Number 4 Region: 611-668
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000089
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 5 Region: 828-906
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000963
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 6 Region: 569-611
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000429
Family EGF-type module 0.015
Further Details:      
 
Domain Number 7 Region: 535-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000443
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 8 Region: 498-534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000536
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 9 Region: 458-494
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000144
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 10 Region: 201-241
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000402
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 11 Region: 1222-1251
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000321
Family EGF-type module 0.011
Further Details:      
 
Domain Number 12 Region: 388-418
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000387
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  W5Q9T5
Domain Number - Region: 422-452
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0191
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W5Q9T5
Sequence length 1332
Comment (tr|W5Q9T5|W5Q9T5_SHEEP) Sushi, nidogen and EGF like domains 1 {ECO:0000313|Ensembl:ENSOARP00000019478} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=SNED1 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
VNNNGIISFLKEVSQFTPVAFPIAKDRCVVAAFWADVDNRRAGDVSFREATDAATLRKAT
ADVRRYFPELPGFSATWVFVATWYRVTFFGGSASSPVNTFQTVLITDGTLSFTIFNYESI
TWTTGTHASSGGDASGLGGIAAQAGFNAGDGRRYFSIPGSRTADMAEVETTTNVGVPGRW
AFRIDDAQVRVGGCGHTTSVCQALRPCLNGGKCIDDCVTGNPSYTCSCLSGFTGRTCHLG
VESGSPRPGHGLRSFSRASCCSQAAARTAVWACCPLGGQGASGAGCGVVRGWCGAERPPL
PPADVDECSSDPCLNGGSCVDLVGNFTCLCAEPFEGPRCETGGRPHTEASLPSVRGRNPQ
RCVSAQEGAPILRPLSPLSVAGTPSGCECRNGGRCLGANSTLCQCPPGFFGLLCEFEVTA
TPCNMNARCPDGGYCMEYGGSYLCVCHTDHNVSHSLPSPCDSDPCFNGGSCDAHGDSYTC
ECPRGFHGRHCEKARPRLCSSGPCKNGGTCKEAGGEYHCDCPYRFTGRHCEIGKPDSCAS
GPCHNGGTCFHYIGKYKCDCPPGFSGRHCEIAPSPCFRSPCLNGGTCEDLGTDFSCHCQA
GYTGRRCQAEVDCGPPGEVKHATLRFNGTRLGSVALYSCDQGHSPSASSHVRVCQPQGVW
SEPPQCHEGAAEARRQPKGRALQRHTRAQDRVAGYLCVCSPGREGAHCERETDKCQAQPC
RNGGACRDLPGAFVCQCPPGFTGVHCETEVDACDSSPCQHGGRCEDGGGAYLCVCPEGFF
GYHCETVSDPCFSSPCGGRGYCLASNGSHSCTCKVGYTGKDCAKELFPPTALKVEQVEES
GVSISWRPPEGAAARQVLDGYAVTYASADGSYRRTDFGNRGRSAHQLRALAPGRAYNVSV
FSVKRNANNKNDISRPVVLLARTRPRPIEGLEVANVTASAISVRWALHRIRHATVSSVRL
SIRHPEAQEEQSTDVDRSVDRFTFRALLPGRKYAIWVTALSGLGGQEHRTESLASAPVHV
WTRPLPPANLTAARVTATSAHVVWDTPSPGASLEAYVINVTTSQSTKSRYVPSGRLASYT
VRDLAPGRRYQLSVTAVQGTGAGQVHSEPAHLHFIRREAQGHGEVAGLLSGAREARLPHG
GLHNPLTCPSSQNSLSGRFSELVDGRGRVRARFTSSPSKRVTVRSQPTALAQLENTDAVP
TPASRALQLPERGGDKDVENAPGNCSENPCQNGGTCVPGEDAHSCDCSPGLQNSRGLRGQ
LLCGDRRGPCHPQTSGSRTRGGWTEVEGGVCRHVYKRVYKAHPDTCFKESCESARARAPD
RKQSDSPTLKKP
Download sequence
Identical sequences W5Q9T5
ENSOARP00000019478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]