SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5QAN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5QAN6
Domain Number 1 Region: 407-530
Classification Level Classification E-value
Superfamily Cyclin-like 1.57e-25
Family Cyclin 0.0031
Further Details:      
 
Domain Number 2 Region: 286-404
Classification Level Classification E-value
Superfamily Cyclin-like 8.02e-20
Family Cyclin 0.0026
Further Details:      
 
Domain Number 3 Region: 32-118
Classification Level Classification E-value
Superfamily F-box domain 0.0000000654
Family F-box domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5QAN6
Sequence length 785
Comment (tr|W5QAN6|W5QAN6_SHEEP) Cyclin F {ECO:0000313|Ensembl:ENSOARP00000019781} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=CCNF OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MGSGGVIHCRCAKCFCYPSKRRIRRRPRNLTILNLPEDALFHILKWLSVGDILAVRAVHS
HLKYLVDNHASVWACASFQELWPSPGNLKLFERAAEKGNFEAAVKLGIAYLYNEGLSVSD
EARAEVNGLRASRYFSLAERLNVGAAPFIWLFIRPPWSVSGSCCKAVVHESLRAECQLQK
THRASILHCLGRVLSLFEDEEKQKQARNLFEESANQGCLTSSYLLWESDRRMDMLDPGRF
LHSFRKLRDFAAKGCWEAQLSLAKACAHRHQLGLEAKASSEIVCHLFQASHAVNKQRVFS
VQKGLNDTMSYVWFGWSVFVRSXKDFSSLCLHLTVECVDRSLQRRLVPRYRLQLLGIACM
VICTRFISKEILTIREAVWLTDNTYKYEDLVRMMGEIISALDGKIRVPTVVDYKDVLLTL
VPMAPRTQHLCGFLCELSLLHTSLAAYAPAHLAAAALLLARLTHGQTQPWTTQLWDLTGF
SCEDLIPCVLSLHQKCFHDDAPKDYRQVSLTAVKQRFEDKRYEEISLEEVLSYGQLCAAL
GVKQESLEPAPFLSAGDIHAFLSSPSGRRTKRDQAGPPDNARARFTPPPAAGLSSQEETL
LGSFLDWSLDYCSGYEGDQESEGEKEGDVTAPSGVLDVTVVYLSPEEHCCQESSDEEACP
EEAWGPQDTQAVAPGHQALRTPGPEPPPCSRWGLGKDITTSGYSSVSSASPTDSGHALGG
PPRATSEQSAHRSWYHHHARKSCLQCRPPSPPESCAPQQQVKRKNLSAHSEKEEEEDMNL
GFLKL
Download sequence
Identical sequences W5QAN6
ENSOARP00000019781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]