SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5QDL4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5QDL4
Domain Number 1 Region: 296-511
Classification Level Classification E-value
Superfamily SIS domain 0.00000000604
Family mono-SIS domain 0.0074
Further Details:      
 
Weak hits

Sequence:  W5QDL4
Domain Number - Region: 80-181
Classification Level Classification E-value
Superfamily SIS domain 0.0207
Family mono-SIS domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5QDL4
Sequence length 512
Comment (tr|W5QDL4|W5QDL4_SHEEP) Glucokinase regulator {ECO:0000313|Ensembl:ENSOARP00000020812} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=GCKR OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MPGTKWFQLVIETPEPGKWELSGYEAALPITAKSNLTRDLDKADAEQTVRLLGQCDAELF
QEEGQVMPTYQLYNESSLTTMEQVAEKVQKVLRVPEDKSLGWGWGLVVLSGGGTSGRMAF
LMSVCFNQLMKGVGQKPTSMLEATGGDCSVVASREGTEDSALEGLRKVAAGKKRAIVIGT
SVGLWAPFGAGQMDYCLDNPDVLPVLVGFNPLSMARNKPISGLWCNSLEVFNHTVNTVSS
LCLGLLCRRSVEREGCSGEKVLGKKSAANILLEALLPAAHKTVDHCSIRTICLLEILQIF
EWASQATYGQSPKIATLMKQASTRYPGEKGQVYLVGWQTLGIIGIMDGVECMHTFGANGT
PVQSFLLEGFSPLFLPQGPHFSFSQEDVLTSILPSLTETDTVLFIFTLDDGLTEVQTLVE
QGKEKTSNIQALAHSTVGQSLPIPLKKPFPSISSITRPLLFFKYEGNFIQKFQYELSTKR
VLNTMIIGAHVLLGQILQNHMLDLLIHNSKLL
Download sequence
Identical sequences W5QDL4
ENSOARP00000020812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]