SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5QGQ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5QGQ2
Domain Number 1 Region: 19-147
Classification Level Classification E-value
Superfamily Lysozyme-like 2.12e-54
Family C-type lysozyme 0.000000772
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5QGQ2
Sequence length 148
Comment (tr|W5QGQ2|W5QGQ2_SHEEP) Lysozyme {ECO:0000256|SAAS:SAAS00814457} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=LOC101102714 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MKALLILGLLLLSVAVQGKKFERCELARTLKRLGLDGYRGVSLANWMCLARWESNYNTRA
TNYNHGDKSTDYGIFQINSRWWCNDGKTPRAVNACRIPCSALLKDDITQAVECAKRVVRD
PQGIKAWVAWRNKCQNKDLRSYVKGCRV
Download sequence
Identical sequences W5QGQ2
ENSOARP00000021901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]