SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5QGQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5QGQ3
Domain Number 1 Region: 19-146
Classification Level Classification E-value
Superfamily Lysozyme-like 3.75e-51
Family C-type lysozyme 0.00000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5QGQ3
Sequence length 147
Comment (tr|W5QGQ3|W5QGQ3_SHEEP) Lysozyme {ECO:0000256|SAAS:SAAS00814457} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=LOC101102714 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MKALVILGLLCLSVAVQGKVFERCELARTLKELGLDGYKGVSLANWLCLTKWESSYNTKA
TNYNPGSESTDYGIFQINSKWWCNDGKTPNAVDGCHVSCSELMENNIAKAVACAKHIVSE
QGITAWVAWKSHCRDHDVSSYVEGCSL
Download sequence
Identical sequences W5QGQ3
ENSOARP00000021902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]