SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5QGV4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5QGV4
Domain Number 1 Region: 39-166
Classification Level Classification E-value
Superfamily Lysozyme-like 8.31e-51
Family C-type lysozyme 0.00000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W5QGV4
Sequence length 167
Comment (tr|W5QGV4|W5QGV4_SHEEP) Lysozyme {ECO:0000256|SAAS:SAAS00814457} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN= OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MLNSKSSSPWSVWTLDFSVNMKALVILGLLFLSVAVQGKVFERCELARTLKKLGLDDYKG
VSLANWLCLTKWESGYNTKATNYNPGSESTDYGIFQINSKWWCNDGKTPNAVDGCHVSCS
ALMENDIEKAVACAKHIVSEQGITAWVAWKSHCRDHDVSSYVEGCTL
Download sequence
Identical sequences W5QGV4
ENSOARP00000021953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]