SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5QI99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5QI99
Domain Number 1 Region: 474-843
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.05e-127
Family Hect, E3 ligase catalytic domain 0.00000000384
Further Details:      
 
Domain Number 2 Region: 7-107
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.1e-21
Family Synaptotagmin-like (S variant) 0.032
Further Details:      
 
Domain Number 3 Region: 419-459
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000131
Family WW domain 0.00014
Further Details:      
 
Domain Number 4 Region: 131-174
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000835
Family WW domain 0.001
Further Details:      
 
Domain Number 5 Region: 291-331
Classification Level Classification E-value
Superfamily WW domain 0.00000000000102
Family WW domain 0.0018
Further Details:      
 
Domain Number 6 Region: 370-405
Classification Level Classification E-value
Superfamily WW domain 0.00000000000223
Family WW domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5QI99
Sequence length 850
Comment (tr|W5QI99|W5QI99_SHEEP) E3 ubiquitin-protein ligase {ECO:0000256|PIRNR:PIRNR001569} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=NEDD4 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MNGIFTSVQTKTIKKTLNPKWNEEILFRVHPQQHRLLFEVFDENRLTRDDFLGQVDVPLY
PLPTENPRMERPYTFKDFVLHPRSHKSRVKGYLRLKMTYLPKTSGSEDDNTEQAEELEPG
WVVLDQPDAACHLQQQQEPSPLPPGWEERQDILGRTYYVNHESRRTQWKRPTLQDNLTDA
ENGNIQLQAQRAFTTRRQISEETESVDNRESSENWEIIREDEATMYGHQAFPSSPPSNNL
DVQTHLAEELNARLTVGGNSATGQPVSNSNHSSRRGSLQAYTFEEQPTLPVLLPTSSGLP
PGWEEKQDERGRSYYVDHNCRTTTWIKPTVQATVETSQLPSSQGSSAGPQPQAPASDAAQ
QVTQPSEMEQGFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPAHLRGKTSLDSSS
DLGPLPPGWEERTHTDGRIFYINHNSKKTQWEDPRLQHVAITGPAVPYSRDYKRKYEFFR
RKLKKQNDIPNKFEMKLRRATVLEDSYRRIMGVKRADFLKARLWIEFDGEKGLDYGGVAR
EWFFLISKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGK
LLDGFFIRPFYKMMLHKPITLHDMESVDSEYYNSLRWILENDPTELDLRFVIDEELFGQT
HQHELKSGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDE
NELELLMCGLGDVDVNDWREHTKYKNGYSINHQVIQWFWKAVLMMDSEKRIRLLQFVTGT
SRVPMNGFAELYGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLPPYESFEELWDKLQMAI
ENTQGFDGVD
Download sequence
Identical sequences W5QI99
ENSOARP00000022451 XP_012036880.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]