SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5QID3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W5QID3
Domain Number - Region: 204-252
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0549
Family TSP-1 type 1 repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5QID3
Sequence length 350
Comment (tr|W5QID3|W5QID3_SHEEP) Chromosome 1 open reading frame 56 {ECO:0000313|Ensembl:ENSOARP00000022485} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=C1orf56 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MVPAAGALLWALLLSLGPRAAGAEGLTSTAMPRDSFRFGGPMTRSYRTTARTTPGVVSPR
MRVTMEDEDDIVAAADSLAGPAAAELLASTVATGSRSRLSQEEDGSLEEGVVIYARKNDT
ESETDSTTRFTPGMPSPYLTANDQDFGKMSSSLPHSTWKANVDSQPSDSTANPWSSAGST
LNQWPPPSPSAMPAPEDLRLILLPWGPWHCHCKSGTMSRTRAGRLHGLSGRLRVGALSQL
RTEHRPCTYHLCPCNREREECPLDAGLCADTRCTTQTTTQTTTRAITTTTTAPFPPLTSR
LRPAPFIPSPIPSPHPAYAFWKRVRIGLEDIWNNLSTMFTEMEPIKRNQR
Download sequence
Identical sequences W5QID3
ENSOARP00000022485 XP_012036289.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]