SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5QJ70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5QJ70
Domain Number 1 Region: 18-79
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000085
Family Complement control module/SCR domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5QJ70
Sequence length 279
Comment (tr|W5QJ70|W5QJ70_SHEEP) Sushi domain containing 6 {ECO:0000313|Ensembl:ENSOARP00000022772} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=SUSD6 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
PTLRYRLPSPLFRGSSAVCSLPPEPENGGYICHPRPCRDPLNSGSVIEYLCAEGYMLKGD
YKYLTCKNGEWKPAMEISCRLNEDKDTHASLGVPTLSIVASTASSVALILLLVVLFVLLQ
PKLKSFHHSRCRRDQGVSGDQVSIMVDGVQVALPSYEEAVYGSSGHCVPPADPRVQIVLS
EGSGPSGRSGPREPHLQDQGACSSAGSEEEAPGQSGLCEAWGSRGSETVMVHQATTSSWV
AGSGNSRVAHKEAPDSENSDIQSLTSEDYRDDIPLLKEA
Download sequence
Identical sequences W5QJ70
ENSOARP00000022772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]