SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5UEQ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5UEQ2
Domain Number 1 Region: 26-137
Classification Level Classification E-value
Superfamily PH domain-like 1.51e-35
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000455
Further Details:      
 
Domain Number 2 Region: 225-293,352-373
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 2.35e-23
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.000039
Further Details:      
 
Domain Number 3 Region: 415-477
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000000000458
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W5UEQ2
Sequence length 488
Comment (tr|W5UEQ2|W5UEQ2_ICTPU) Wiskott-Aldrich syndrome protein {ECO:0000313|EMBL:AHH40433.1, ECO:0000313|RefSeq:XP_017323358.1} KW=Complete proteome; Reference proteome OX=7998 OS=Ictalurus punctatus (Channel catfish) (Silurus punctatus). GN=was OC=Ictaluridae; Ictalurus.
Sequence
MSKGKAKGQENMPSSLLSIQENERLVDLLGRRCVSLATAVVQLYMALPHSPAHWSLQHTG
VACFVKDNPRRSYFIRLYDIKEGKMIWEQELYNQMTYSSPKQFFLSFPADDCQVGLNFAS
EQESDLFRNSLEEKINQRANRQEKRQSSPTEEKRALPPTPPSNGPLMLPGGMATIDIPNP
DILASRYRSSSVPVPAPASFCKGKKDKKGKKKGPRLTKADIGAPSGFKHVTHVGWDPNTG
FDTNNLDPDLKKLFSCAGISEDQLTDKETSKLIYDFIEQSGGLDAVKEEMRKQDAMVPPS
RSIPPVPSGAPAAPPPRGDRNLPPVPGQPPPATSRNQRAPLRGPVPPPPPTGRTGPPPPP
PPSGGYSAPPPPPPSSSMGGGGAPPPPPPPPPPPPPAPVISSNSSSPVSPSTTSGSGRGA
LLDQIRLGTKLKTVTDSPDPHPSSQDQGGEGIVGALMMVMQKRSKVIHSSGDEEDDGGED
EDDDEWDD
Download sequence
Identical sequences W5UEQ2
XP_017323358.1.5077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]