SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W6GEY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W6GEY6
Domain Number 1 Region: 34-64,101-130,226-258,343-393
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000000615
Family Pseudo ankyrin repeat 0.045
Further Details:      
 
Weak hits

Sequence:  W6GEY6
Domain Number - Region: 231-285,333-370,419-494
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0249
Family Ankyrin repeat 0.019
Further Details:      
 
Domain Number - Region: 471-575
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0327
Family Pseudo ankyrin repeat 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W6GEY6
Sequence length 633
Comment (tr|W6GEY6|W6GEY6_MIMIV) Uncharacterized protein {ECO:0000313|EMBL:AHJ39976.1} OX=1461100 OS=Samba virus. GN= OC=Viruses; dsDNA viruses, no RNA stage; Mimiviridae; Mimivirus.
Sequence
MDNLFGKMFYLIKQIGTDQYPMYLIIDRLNIISFLNEKKKTTLTLVEPDYSNPFFKIVKH
NDKQTYLTNYIIKYEQCDLLDISNIDYILDTNKMPQYTCRLFRFFIANDRYDICDYLIHN
RGIKYNYESIPSILHILDDEKEPALLEYIIANIDYFDIDLTFIIRHVLLFFNKDTQYFLD
KINSLAQTKGIEISNKDYCDIANDLIESYDPDIESIKLFLDMGYINGNQIFIIACNFFSD
LVKYLVEQNVNYDINDVLKINVSANILEYFHQKGHVFTDENIRDIMINLTEFEDIEKIKY
MCSEKILCQEHIDSDFLTQLINKNFTNYLEILISEFDIRELIDIDCLMKKAISLDSPEIV
NYCIQNGIDVENYLGLVFEHSSQKLLNMLMASGIEVPEKLSLLGLKSFENMDFVNVYINE
YNYNLPYMFKMTLKNGTLKTFKYVIDTMIQKQQPIPDFVKLLVKYTLDKNMYTQKKNKEI
VNCLINLDIEYNPLQQTLIALIKKDSNRVKNLIHENILYRSLVVLFMTVLTKNIDVLTLL
LEKNTDEKYIKWASIFSVCDYETFRFVIEHTGVDIQRYQEEIILMSGICYNYNNYRYLKL
MGFPDIYTAKKTIDKNGPVKYFVEFMKQYDISV
Download sequence
Identical sequences A0A0G2Y4W0 A0A0U2UHZ8 A0A165XC38 A0A1E1EVM9 E3VZ91 Q5UQC5 W6GEY6
gi|311977604|ref|YP_003986724.1| YL228_MIMIV YP_003986724.1.55212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]