SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W6NY09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W6NY09
Domain Number - Region: 54-89
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0017
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W6NY09
Sequence length 102
Comment (tr|W6NY09|W6NY09_HAECO) Dpy-30 motif domain containing protein {ECO:0000313|EMBL:CDL96687.1} KW=Complete proteome; Reference proteome OX=6289 OS=Haemonchus contortus (Barber pole worm). GN=HCOI_01927000 OC=Haemonchus.
Sequence
MTVQENASAAPAAAPAAPAPAQVAPPATAAATAAPQAAGVLAPPRAAPAIPTRQYLDQTV
VPILLQALGALAKDRPENPIDFLINFLIKEKERYQPSTENVS
Download sequence
Identical sequences A0A0N4WSJ9 W6NY09

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]