SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W6YKB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W6YKB5
Domain Number 1 Region: 43-254
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.44e-17
Family Carboxylesterase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W6YKB5
Sequence length 280
Comment (tr|W6YKB5|W6YKB5_COCCA) Carbohydrate esterase family 1 protein {ECO:0000313|EMBL:EUC31716.1} KW=Complete proteome; Reference proteome OX=930089 OS=Bipolaris zeicola 26-R-13. GN=COCCADRAFT_100584 OC=Pleosporaceae; Bipolaris.
Sequence
MLRPASIFALGALLFLSLLDSVSAATAGCGKTPRLNSGVHTITVNNKQRRYTLRVPQNYD
NKRQYRFIFGLHWLNGDMNAVASGAAPYYGLAALAGESTIFVAPDGLNRGWGNQNGEDIA
FLDAVRKQIDDEFCVNEKLRFSLGFSYGGAMSFSLACSKAADFRGIAVLSGATLSGCAGG
NTPIAFYGQHGVKDSVLPISSGKQIRDRFVQLNGCQSKNAPDPSPNSRQRVKTVYDGCKY
PTQWTSFDGDHVALPGDAGNDVGAQSFTPKEVWAFFSQFT
Download sequence
Identical sequences W6YKB5 W7ERQ9
jgi|Cocvi1|23513|gm1.2117_g jgi|Cocca1|100584|e_gw1.116.26.1 XP_007713985.1.9443 XP_014560296.1.39273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]