SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W6YR58 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W6YR58
Domain Number 1 Region: 1-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.98e-22
Family Ubiquitin-related 0.00041
Further Details:      
 
Domain Number 2 Region: 257-318
Classification Level Classification E-value
Superfamily XPC-binding domain 5.36e-20
Family XPC-binding domain 0.00031
Further Details:      
 
Domain Number 3 Region: 309-376
Classification Level Classification E-value
Superfamily UBA-like 6.99e-16
Family UBA domain 0.001
Further Details:      
 
Domain Number 4 Region: 122-182
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000258
Family UBA domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W6YR58
Sequence length 379
Comment (tr|W6YR58|W6YR58_COCCA) Uncharacterized protein {ECO:0000313|EMBL:EUC33961.1} KW=Complete proteome; Reference proteome OX=930089 OS=Bipolaris zeicola 26-R-13. GN=COCCADRAFT_36312 OC=Pleosporaceae; Bipolaris.
Sequence
MKITFKDLKQNKFVIEAEPSETIGALKSKIQAEKGWEVPQQKLIYSGKILQDANTVESYN
IEEKGFIVCMVSKPKAAPAASSSKAAPSTPAPAPAQTPSAPQAPTQSSTTHNAPATPSPA
PAQASGERFNDPSALTMGGEREAAIANMESMGFARADIDRAMRAAFFNPDRAVEYLLTGI
PESALQEQAQQTQARAPNSPTPAGGNAGATAQANPSSGGDEPMNLFEAAAAAQNRGGAGG
ARSGGTGGAGAGALNANSLDFLRNNPQFQQLRQVVQQQPQMLEPILQQVGAGNPQLAQMI
ASNPEQFLQLLAEDADEDAPLPPGAQAISVTEEEREAIERLCRLGFERDLVIQAYFACDK
NEELAANFLFDQPDDADDQ
Download sequence
Identical sequences W6YR58 W7EDJ2
XP_007711761.1.9443 XP_014558112.1.39273 jgi|Cocca1|36312|fgenesh1_pm.63_#_26 jgi|Cocvi1|36518|fgenesh1_pm.29_#_59

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]