SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7BX01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7BX01
Domain Number 1 Region: 194-337
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00000000581
Family Carboxylesterase/thioesterase 1 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W7BX01
Sequence length 357
Comment (tr|W7BX01|W7BX01_9LIST) Two component regulator three Y domain-containing protein {ECO:0000313|EMBL:EUJ27876.1} KW=Complete proteome OX=1265820 OS=Listeria cornellensis FSL F6-0969. GN=PCORN_12902 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Listeria.
Sequence
MISDIIIEKLDTSHLAYMNGKLVVNFKALFMLKASYTYAYYIYYNDQIIERQWYQPIDKQ
QVTVNYQPIRSGAYKIRLFLKKDDMVIINKLTNMLNVDVTNQQTVTTTLEKEEIYYNDNP
VKFLFQRARTPSDKLLISFSGLHSNEFCGGAPVYNHFRTLWPCDVNKLFILDEYKGQFCY
YMGHDCRSDYERSVIALIMTKANELGISSRNIIASGSSKGGAASLYFAMKYHFGTAIVGA
PQVFIAQYLKQLAVDGPYVHVRKALDKMLGEDKETGEKYYDELIMNLVDTNTTFPAFTFH
VGQGDFHYKQHLQPLLQKLDKKGVAYELDLQDYSDHNQTGQYYAPFLFETVSKMIQK
Download sequence
Identical sequences W7BX01
WP_036080489.1.47240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]