SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7CKW0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7CKW0
Domain Number 1 Region: 1-368
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.11e-70
Family O-acetyltransferase 0.00000944
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W7CKW0
Sequence length 368
Comment (tr|W7CKW0|W7CKW0_9LIST) Probable acyltransferase {ECO:0000256|HAMAP-Rule:MF_00296} KW=Complete proteome; Reference proteome OX=1265817 OS=Listeria floridensis FSL S10-1187. GN=MFLO_00675 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Listeria.
Sequence
MIVEKKSFQIENYKLENGAEIPVTLGYETYGTLNADKSNAILVAHYFSASSHAAGKYSED
DAAPGYWDALIGPGKAVDTDKYFVISTDNLANVQFNNPTVITTGPRSINPKTGKIFGSSF
PAFTFKDVAGIQHEFITKQLGIEKLYAVMGASAGGFISLNWAVEFPERMEKVIGVITNPQ
NPVMTSFSVLQHAMRAIALDPNWNGGDYETGNGPKEGLKMAIQMMNAGAFSPKFYEETYV
RDSAEERPYADVFEATSYERKLDEAVSATFDSIDASHWYYTCRATMMHDLAHGNGSLEEA
LDKIKADLMLVSCTQDQLQPTVFNVEMVEMMEKIGKKVELVKITSDKGHMAGVLEGNLFA
QNLKEFLA
Download sequence
Identical sequences W7CKW0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]