SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7CYC2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7CYC2
Domain Number 1 Region: 2-227
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.84e-31
Family Carboxylesterase/lipase 0.000000567
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W7CYC2
Sequence length 230
Comment (tr|W7CYC2|W7CYC2_9LIST) Carboxylesterase {ECO:0000313|EMBL:EUJ41942.1} KW=Complete proteome; Reference proteome OX=1265861 OS=Brochothrix campestris FSL F6-1037. GN=BCAMP_00965 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Brochothrix.
Sequence
MLLHGFTGNTTDVRMLGRFLENENITSYAPLYKGHGLEPEMLLETTPADWWQSAVDGYDF
LKKEGFDEIVVMGLSLGGAFSLKLGYSKPVKGIVTMAAPAKVDGDSPIIAGFSRFAANYK
KYEGKDEAQIAREMARFDSASFETITKLAAEIQTIRQNIDMIYAPILVTQGEQDKMVAAE
NAKYIYNHVESVQKELKWYPQSGHILTLDKERNQLHQDILTFIESLDWSN
Download sequence
Identical sequences W7CYC2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]