SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7ESE3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7ESE3
Domain Number 1 Region: 91-407,435-451,480-500
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.81e-85
Family Duffy binding domain 0.00013
Further Details:      
 
Domain Number 2 Region: 491-692
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.44e-29
Family Duffy binding domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W7ESE3
Sequence length 771
Comment (tr|W7ESE3|W7ESE3_PLAF8) Uncharacterized protein {ECO:0000313|EMBL:EUR47040.1} KW=Complete proteome OX=57266 OS=Plasmodium falciparum (isolate 7G8). GN=PFBG_06183 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MEPKVAVTDYSSAKDFLDKFGQQVYDQVKKDADAEAYKNKLKGDLSRAKFDRNQSGQQTE
NDPCNLSYEYHTDVKNSGEKEYPCAKRSDVRFSDTEGAECDNRKIRDNDKKTGGACAPYR
RLHLCDYNLENINDYENITNDTLLVDVCLAALHEGQSIAGQHGKYHTHSSGSTICTVLAR
SFADIGDIVRGKDLYRGNNGKDKLEENLKKIFEKIHDNLKNKEAQEYYKNNDDPYYYKLR
EDWWTANRATIWEALTCEVGSGTYFRPTCGDNENTATQAKNKCRCKDEKGKNDTDQVPTY
FDYVPQYLRWFEEWAEDFCRKRKKQLENAKKQCRGDSGKPKYCDLNGLNCERTKYKIGYF
VEGADCKKCSVACKRFVEWIAKQKKEFEKQKNKYDEEMKKYTNGESGSRRLRRGASTTNY
NGYEKIFYDKLKGHYSDVGEFLEKLSNEEICKKVEDDKGGKIDFKTVDGGGVGGRGGASD
SNNSNKTFAPTEYCDPCPMCGVDCSNGTCTKKDENTCTEETTEKKYPDTNTTKIPKLTAE
KRKRGILQKYSKFCKNTNDQIENWQCHYEKTDKSNICVLQKEKQDTKEQKVTSYYSFFYG
SIIDMLNESIDWKDKVNSCINKAKEGKCRKLCKNPCECYKRWVEKKQTEWTQIKDYFLKQ
EDLLKDIEGMDPGDFLEYYLKNNFLEDMKEAQGDPKVIEKFKEILPKENEEDMLIFLNKK
RIIEEFLEKEKQKADECLKTHKDPCPQSSTPPGDLARAAVPSREQEPPKDE
Download sequence
Identical sequences W7ESE3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]