SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7EY15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7EY15
Domain Number 1 Region: 56-280,311-360,383-419,456-514
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.67e-86
Family Duffy binding domain 0.00046
Further Details:      
 
Domain Number 2 Region: 507-627
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.000000549
Family Duffy binding domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W7EY15
Sequence length 642
Comment (tr|W7EY15|W7EY15_PLAF8) Uncharacterized protein {ECO:0000313|EMBL:EUR68658.1} KW=Complete proteome OX=57266 OS=Plasmodium falciparum (isolate 7G8). GN=PFBG_03889 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MGLKKPVATQGGGQVGGSSQDAKHVLDEFGQQVYNEKVKTEAQTYKGELEGLLTSATLLR
ELVGTTDTCTLVKEYYERVNKGGGGKGERYPCTNLKGNPNEERFSNTLGGQCTNEKMRSD
GIGACAPYRRLHLCHHNLESIQTNNYNSGNAKHDLLAEVCMAAKYEGESLTRYHREYQHK
YGDSPSQLCTVLARSFADIGDIIRGKDLFYGNTQEKEKRDKLEDNLKNIFAKIHSGLSNN
VVKDRYQNDGDNYYKLREDWWTANRETVWKAMTCSEDLKDASYFRQTCSNGQHKTQNNCR
CENKSGAKDADQVPTYFDYVPQYLRWFEEWAEDFCRLRKHKLKNAKEQCRRVEKGEHKYC
DLNRHDCVKTIRGDHDFVEEDYCNDCSVACKPFVKWIDNQKLEFLKQREKYKSEMQKYKN
GGGGSGSRRQKRDAGGATTTNYDGYEKKFYEKFKGKCGTVNKFLQLLNNETTCTKNGDIE
EGGNIDFKNVKRSSATGDDSNKTFYRTTYCEACPWCGAEQERNGGNGKWIAKRDETCGIG
KEYGDYKKTEIPILTGDTRKSDMVQKYKKFCDSVNGKNGEPGAPSAAKGGGKGKNGDNIT
ETWECYYKKKNENDVGSRAINFCVLQDDKAGTSKKKKIQYVL
Download sequence
Identical sequences W7EY15

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]