SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7F015 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7F015
Domain Number 1 Region: 1-73
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.3e-18
Family Ubiquitin-related 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W7F015
Sequence length 77
Comment (tr|W7F015|W7F015_COCVI) Uncharacterized protein {ECO:0000313|EMBL:EUN32509.1} KW=Complete proteome OX=930091 OS=Bipolaris victoriae FI3. GN=COCVIDRAFT_84908 OC=Pleosporaceae; Bipolaris.
Sequence
MILVTINDRLGTKTQVPCLPSDPIKLLKAMVAAKIGRPVHEIMLKRQGERPFHDNLTCAD
YAISNGVQIDLELNTGD
Download sequence
Identical sequences M2SM56 M2TLT5 N4X3U6 W6Y278 W6YS90 W7F015
jgi|CocheC5_1|109589|estExt_Genewise1Plus.C_150409 jgi|Coclu2|54964|fgenesh1_pm.17_#_340 jgi|Cocca1|95005|e_gw1.65.114.1 jgi|Cocvi1|84908|e_gw1.2.500.1 jgi|Cocmi1|108708|e_gw1.243.9.1 XP_007692996.1.18027 XP_007695253.1.66866 XP_007711854.1.9443 XP_014080259.1.79200 XP_014562130.1.39273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]