SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7F0X7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7F0X7
Domain Number 1 Region: 20-332
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.51e-61
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.019
Further Details:      
 
Domain Number 2 Region: 439-656
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.81e-19
Family delta-Endotoxin, C-terminal domain 0.091
Further Details:      
 
Domain Number 3 Region: 338-435
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000000235
Family Rhamnogalacturonase B, RhgB, middle domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W7F0X7
Sequence length 658
Comment (tr|W7F0X7|W7F0X7_COCVI) Polysaccharide lyase family 4 protein {ECO:0000313|EMBL:EUN29907.1} KW=Complete proteome OX=930091 OS=Bipolaris victoriae FI3. GN=COCVIDRAFT_91675 OC=Pleosporaceae; Bipolaris.
Sequence
MRAITVTATLLFCTNTWAFLKASQNNQSLTIANNRLVASVSKSKGYINVLTLDGQNLLGT
ESGNTGVGPYLDCYCTPSGFWTPGRGKDVHYQLFNGTDSTGTPYGGISMGETYAPTGQRL
EQYWFLREGETGLHTFSRIVYHNETTPFLRNLQEFRTLFRPNHDPPLFTHFITNDKFSAP
RPDQNGQVVVQDATWQLVNKDDPYVKGVGDYFTKYTFQDSWRNHLAHGMYADGRTTNGTT
YGAWLVHNTVETYFGGPTHSDLVVDGIVYNYMVSNHHGAQTPNITNGFDRTFGPQYFHFN
TGGTLSELRKDAEQYGQRPDWNAPFYDSIAAHVPNLITSSARGTFSANIALPTGAQNPIA
ILTTTGHNYQDNAANSTAYQYWTPIPSTGTISIPRVKPGSYRLTLSASSIFGDYTHDSLL
ISASQTTSLNITWTPESAGKELFRIGTPDKSSGEFLHGTAPSPTHPLLTEEYRLYWAAYD
FIRDFPTGIHFRVGKDDPAQALNYVHWAVFGGKANSLRPVPVPDHVYDWSIRFDVEEGDV
KESGKATFTVQLAGAKTAAGNTDLDTGERWANLPLRVMVNGEVLEDWVIPYYQSSSCAVR
SAVSCYHLAHKFVFSGDLLKEGENEIVLALPYNATGNESAVLPEAVYVQYDALRLEVE
Download sequence
Identical sequences W7F0X7
jgi|Cocvi1|91675|e_gw1.18.70.1 XP_014559503.1.39273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]