SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7F2Q8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7F2Q8
Domain Number 1 Region: 43-261,291-397,433-495
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.44e-80
Family Duffy binding domain 0.00032
Further Details:      
 
Domain Number 2 Region: 1388-1405,1438-1497,1538-1653,1699-1874
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.4e-77
Family Duffy binding domain 0.0006
Further Details:      
 
Domain Number 3 Region: 855-1193,1250-1269
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.44e-75
Family Duffy binding domain 0.0000489
Further Details:      
 
Domain Number 4 Region: 2219-2599
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.05e-72
Family Duffy binding domain 0.00015
Further Details:      
 
Domain Number 5 Region: 1863-2088
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.62e-38
Family Duffy binding domain 0.0034
Further Details:      
 
Domain Number 6 Region: 526-716,766-786
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.68e-33
Family Duffy binding domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W7F2Q8
Sequence length 2687
Comment (tr|W7F2Q8|W7F2Q8_PLAF8) Uncharacterized protein {ECO:0000313|EMBL:EUR54729.1} KW=Complete proteome OX=57266 OS=Plasmodium falciparum (isolate 7G8). GN=PFBG_06055 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
DAKHVLDEFGQQVYEQVKNGADGTAKNYIGELKGDLNKATNIIPELIGNIETCNLVQEYY
KQTNGGGGKGKRYPCTELGEKVEVNRFSDTLGGQCTDSKMRSGGKGACAPYRRLHLCHHN
LESISDYDSNAKHNLLVDVCMAAKYEGNSIKTPYPIHQQKYKDTGTASQLCTVLARSFAD
IGDIVRGRDLFLGNTYESAQRDQLDKKLKEVFGKIHGGLSEEAKGHYKDPDKNYYQLRED
WWTANRHTVWEAITCEAKTDDKYFRKTCCSGEWTDDKCRCKDKKTGKNDTDQVPTYFDYV
PQYLRWFEEWAEDFCRLRKRKLKDAKSKCRGENNDKYCDLNRHDCEKTASGKHVFVEEDN
CIGCHFSCSHFVKWIDNQKLEFEKQVKKYKSEMQKYKNGGGGSGSGRKKRAAGKSNYDGY
ESKFYKKMKEKNNYETVENFLDLLNKEDVCTKKLNDQDEEEGKIDFKTVKSSSAADGGDG
NNKTFDHTTYCQACPWCGAEKDNTGKWTPKDETCGKGKDYTNYEDTQIPILTGDKTKSDM
VRKYKKFCNGNGGKGVTSGATGEKGKNGDNITETWKCYYYKENENNVGKKDINFCVLQDD
KVGTSKEKSMHYNSFFWKWVYHMLHDSLDWRNELGSCINNNTNDNTCRNNKKCKNPCECF
EKWVDQKKETEWEKIKDHFKKQKDIVEQTGCDPGVTLAAVLDKDLLLKSIEDTHVDAKDI
ERIGKMLKETGVLGGVAAGGPGVAGFLPLLGGDLGTTGCGVKGANGQNSIIDKLLQHELN
DATKCKNCQPTKVKNPCYGDKQYPALAEKVAKEMQGDAHTKMLDRSGKNGETKSSLEGDI
KKAEFKNGGEGKNLNGDICKIDTTYSNDSRSNTTDGACTGKDGSNGGVRMKIGTIWQTGE
GIKISDPHLYLPPRREHMCTSNLEKLSVGSSGLKGDKAIHSLLGHVLLSANYEAHNIKTK
YKQNEGKKELNDQNDKKTVCRAMKYSFADLGDIIKGTDLWDANENEKRTQGHLNEIFHNI
YNNNSDIKEKYKNIDDDKHTKLRKDWWEANRETVWEAMKCKTPHGNFPCSGTDVPLEDYI
PQRLRWMVEWAEWFCKDQSRLYEELLQKCGKCKDKKGGKGCMQNTQECNDCKQACDKYKT
KINTWKQQWKQMELEYTPLYWQAENGSYGMAFPGADYQQMLDFFKELQKTIRSSSSKRPK
RSTPTDPIFTSPYFTAEGYIQQEARTGQCLVQNEFCEYKNGLTSRSSDAKENKNYAFKNP
PHGYDLACTCNTSNTGSRARSEEPPGTPPPSVPTDDDNYASSEDEDEEEEEEDHDGTHSD
QEEAASDETEGAVEKTVNGDGQGEDKTQDEGEGTTTKDEVTPPEKKDKVNPCQIVDKLFK
NPEDFTDACTLKYVTGKNYGWKCISGDKTATISEGSGGSERSGRKRREADSGKPTSDKGS
ICVPPRRRKLYLGGFDKFISGQTTPATSSQSPNGDPLLAAFVESAAVETFFAWHKYKEEK
KPQGGGLPGVGVAPGVGVGNGGDGEEEEQPPQNQLASGTIPTDFLRQMFYTLGDYRDICV
GNTPSGIDTVSASGDNPTNKVTMKQISSKIEEILKNGDNNKPSGVQNSVNDPLQNGDTSP
QNSDKRTNWWNNNAKHIWKGMVCALTYEENGSGGEGKTIEQVKTAKGDDLFQQLKTQYGD
YENVKLENSETKAKSNDDPINNPKLKDFVEIPTYFRYLHEWGQNFCKERKKRLAQIKEDC
MDDNKQKYSGDGEECEKILVEEANTFKDLEYRTCAKPCRWYRKWIEKKKTEYDKQEKIYG
QQKTDAKSDNGNKYDSNFVGKLDKDYASIESFLGKLKNGPCKNNNGNEKKGQDKKFFEDT
EKTFGHEKYCGTCSKFRIKCDNDKCTSGDTNVTCNGKTDISANDIGNGGNSIGNIDMVVS
DKDANGFNGLEACKTSGIFKGIRKDEWKCRNVCGYVVCKPKTSDGKENKEQIIIITALLK
RWVEYFLEDYKKIKHKISHCKENDEKNICKKDCQNKCKCVKAWITKKSAEWENIKTRFIE
QYKIENDEYYYVRSFLETFLVQIGAANANNDGKKLIKLSKFGNSCGCSASAHKQKDSKQD
AIDCMLKKLEDKIGECEKKHGEKSVQTCSPSETPENNLPLPDDEEDLLLEETENQVKAPN
ICPPTPAETVDEGGCKPAPTRPKKPAPLLPRPKTHLTEYWSDSWRTSTTPRILGKWKGRK
IITTCEIVGEIINKSKGGTKSIDGCHPKNYDKKYAGWECDKSSNLVKENGICMSPRRQKL
CVHYLKQSMTNSDGLKKAFVKCAAAETFLLWQYYKSKNGNANNLDNTLKGGNIPEEFKRQ
MFYTFADYRDLCLDTDLSSKTDMRSAVSIAKYNIYEVLNKSYQTSIDQRKIWWEKNGPSI
WEGMLCALEKTLDDKKKLNYKYKYESVTFGDSSGPNLQTFSSRPQFLRWFTEWGEDFCKE
QKKELDILLKACKYCTVSEGGISEGTKTCNDKENCDACKQACDVYKNFIQTWKRHYEKQK
TRYNEVKGTSPYNNDNDVTESTEAYEYLDTQLKNMMCTNESTYKNCDYTCMKNVSTQKNS
EKIPQSLDDTPNEYKDRCNCVRDECSGLSVTDSGFPDVSAFAGGIPSGRCKAFESPPKKN
EPPQYDPTNDILKSTIPVIIVLALGSIAFLFINEHIYKKKHREILEY
Download sequence
Identical sequences W7F2Q8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]