SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7F332 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7F332
Domain Number 1 Region: 73-475
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.84e-77
Family Duffy binding domain 0.00017
Further Details:      
 
Domain Number 2 Region: 2040-2380
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.27e-76
Family Duffy binding domain 0.000059
Further Details:      
 
Domain Number 3 Region: 1232-1599
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.02e-74
Family Duffy binding domain 0.0001
Further Details:      
 
Domain Number 4 Region: 792-1138
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.57e-66
Family Duffy binding domain 0.00019
Further Details:      
 
Domain Number 5 Region: 2511-2864
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.53e-63
Family Duffy binding domain 0.0000986
Further Details:      
 
Domain Number 6 Region: 1623-1961
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.83e-54
Family Duffy binding domain 0.00022
Further Details:      
 
Domain Number 7 Region: 2869-3163
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.19e-50
Family Duffy binding domain 0.00021
Further Details:      
 
Domain Number 8 Region: 510-718
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.26e-31
Family Duffy binding domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W7F332
Sequence length 3643
Comment (tr|W7F332|W7F332_PLAF8) Uncharacterized protein {ECO:0000313|EMBL:EUR59245.1} KW=Complete proteome OX=57266 OS=Plasmodium falciparum (isolate 7G8). GN=PFBG_05943 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MGNEQSSSSSEGAKNPSIIESQNSPRNVLERYGEGIMIKEKDEARIYENSLKGQLKQAKF
RGGPSTSVDEQYYYYPYPCSLNHNEHTNIRHDNVDERHPCHGREQNRFGEGQVSECSNSK
IKGHENKSDGGACAPPRRRHMCDKNLEALTVENTQNCDDLLGNILVAAKYEGQSIVNNHP
DKNNSNNKSSICTALARSFADIGDIVRGKDLFLGAPNKEKIKLEENLKKIFDNIKNENAE
LSKLSLEKVREYWWAIHRKELWEALTCSAPKGANYFVYKLDRPKFSSDRCGHNYNGDPLT
NLDYVPQYLRWFDEWGEEFCRKRKIKLENVEKACRKDSEKLYCRHNGYDCTKTIKNENIL
FDDPKCTDCLIKCSLYEIWLDNQQKEFEKQKEKYEKEIQTYISNNEISNNNISNEYNKQI
SEKYTDKKYETLDKFLNLLKEGKYCKERMTGESSIDFNNDVDKTFSYSKHCKVCPHCEVD
CENGNCEVKNKPDGNCGKNVKYKPPYGVKPTEITVLYSGNEKGDISKKLSEFCSNKNNIN
VKNNETWKCYYKNSDNNKCKMESNSENNKGAEKITSFHEFFELWVKNLLKDTMKWENEIK
DCINNTNITDCNDECNKNCVCFDKWVKQKEEEWKNVKKVFENKKYIQDKYYLDINKLFES
FLFKVISELDQGEAKWNQLKEELKKKIESSKANEGIKDSESAIELLLDHLKESATTCKDN
NANEACSSSQKSSPNPCADKSGGKLVSVKQIAQYIKRQAYEQANYRSDGLHKLKGKAHEG
KYKRKGRENYFKDKLCKIGKYHSNRDPFESKGPCYGKDGNKLSFQIGTDWKGAEEEKMIY
NDVYLPPRREHMCTSNLEHLVTDNKPLDGTDGNPKLVNNSFLGDVLLSAKYEAQRTKEDY
EPVSDEQSICRAVRYSFADLADIIRGRDMWDKDDGAQKMERILKSIFKNIYETIGDKKGK
YTNTDGKYLELREDWWEANRAKVWEAMKCAIKGLNVTSSDGKLSDHCGYSDHTPLDDYIP
QKLRWMAEWAEWYCKVQSQEYDKLKKSCVMCMQKDNGKNCWKHNSECGVCKGACTAYQGK
LLPWEYQWNVISHKYETLYEKARIAADNGGLDTSSGDIDPKDKTLVEFLFNLYVQNGGKI
GTIGTTGDKDTRDTTPTVYSTAAGYIHEEAHIGDCKEQKKFCEKKNGAKPPSGDLEVDNE
YAFRDKPTDHDKVCDCESGEKLQNKKSEGIVLVEPCNVVNTLLKDKNENSDIDQCIRKYK
DGKEKYPGWDCTRNKIKIGEEGAYMPPRRQKLCVDFLKQLKDQTDEKLRDAFIKSAAAET
FLSWHKYKEDTQKEKATHTADNDLNKGIIPEDFIRQMYYTFGDYRDLCMNKNIGNDVSNV
ESKIEGVFSKADGTSSSNLSREVWWKKHGPKIWEGMLCGLSHAGGNDAIKSNQDYQYSEV
KIFKQSDGSGITLSQFAERPQFLRWITEWYDDYCHTRQKYLKDVKEKCKSNDQLKCDKEC
NNKCDEYKKYMEGKKKEWDAQYKYYKEQRNKKEVVNDSKGIIVKDYVLANAKEYLKKKFT
AICVTSSGKAQNSATEEVKKNIELLSEGQYYDAKEHCGCTKFIHDDKYSKISGRSNCCGL
NSDAKKNKIKWRNSDEKDYAFLKERNLSGDVFFPSRRLGICFRGLDGYYRYPEVKDKDTL
RKTLMEVAATEGYNLGQYYKEKKKANKEAYRYSYEVRPYSAMKYSFYDLRDIILGYDNLE
DNSTTTEKNLKEIFKNESKEDSQGRQTFWNNNKDCVWEAMKCGYKKSGETIPDEFKNMPS
DSDYPIGSNRDEGTAYQFLRWFAEWGEDFCNQRKKQLETLKEKCPGDICSKDTRTQKQCT
DACKNYGEFINQWKLQYKEQRNKYRIDKVTKNKNHPVAKDAKDAREYLDKQLQKFCENKS
GDCEYNCMKDASTQLLTDGHSQNMPASLDDEPKEVEGKCNCQVAPGPPRVRRETPSPRVS
LIPKAVASKKKAKTATPTKQPKKVENPTTEMRARKRTRRAAQQTQTRTARAAPQELTRTS
TPTTTPSDVFKIVKSVLSKNPDIKGGIEKCYPKTNGQYPQWDCTPSKFKKNENGACMPPR
RKKLCINNLQYLNNKTETKNENDIKEAFIKCTAIETHFLWKKYKGNNHELDEKLKDGDIP
KDFIRIMFYTFGDYRDIFFGTDICKDKNIDTISQNVEKLLTKEKDDILKTMDEIKRHYWE
QYGPDIWKGMLYGLTYHLNDEGGNRIPEDSKYQYNTLKPDLEKFAKRPQFLRWFTEWAEE
FCNKRKEQLKKLEAGCKEYECNGSDDGKTQECAEACVTYQKFIKKWKTEYERQREKFKKD
KDGKKYKDYPSTERDIEKATCAHEYLNMKLKELCGNKDCSCMQKPSSQLPKTTQQSQSSD
ANDMPESLDYVPEEFNKCECPELSKKGSMIHTKKITEPKIPMNCVEKAAYYLSKEAENNM
DITLKEKFIPIESTKEKESKNSWTNNNPCDPKKPYSPHKYVSISPCEGKGKDRFKVHSEL
KCYKNLKGYTETKTVCVPPRREHMCLRNLDEIKIERLKDSNYLLKMVRRTARNEGIDIIK
NFNSENGCAMNPICDTMKYSFADLGDIVRGTDMLRIGGYLPPVEIKLYKVFEYIYGKWRN
KNKGRNKYNDVQTFRSAWWDANRKDIWKAMTCKAPEDAKLFRKGRMDGFERITLIQDKCG
HKDDPPVDDYIPQRFRWMTEWSEYYCKALIDELEKFKKSCDHCKTIDRCKNDYDKNKCEE
CKTRCQEYKNFVLKWKSLFDIQSNKYKELYEQPIDTKISAYDHVQNFVQKLKSFKSECSV
ESFSEYLHETSKCLNYKFNENDGSNIRSYAFEETPKSYKEACSCTLPSKNPLDNCPTDKN
KDGCKELQTFTFCSKNDYDNNLDNWNAYLVLNSSDDNKGVLIPPRRRHLCTRPITAYNYR
KGDKEILKKKLLTSAFSQGQLLGQKYKSEKELCFEAMKYSYADYSDIIKGTDMMDTSLSE
KIKKIFETSNEATEDRKTWWENNRRQIWHSMLCGYKIATSNVTLDEGWCELPKDEETNQF
LRWLIEWAKQACKEKKHITNSLKTKCRCSNKDNFKASELLRQPGCQNDIRKYISLNILIQ
NSMENLNIKYKKFKDQSSGNIDNKPSEENVQSYIKSKDSQCALELNDINEIVTGTKNNEN
NEFKEVLKKLYPGLYFVEDETHKNHVLDGNIKEEEQTVRPEVLYFFTPHGDYLYQRPFLP
TYRVEKYDPKNDILKSSISVVIVSALGLIALLFMKKKFKSSVDLLRILNIPQGEYGMPTL
ESKNRYIPYRSGPYKGKTYIYMEGDTSGDEDKYMWDLSSSDITSSESEYEELDINDIYVP
GSPKYKTLIEVVLEPSKRDISSDDIPSDDTPSNDTPRTNRFIDDEWNELKHDFVSQYLPN
TEPNNNYRSADIPMNTEPNTLYFDNPEEKPFIISIHDRDLYTGKEISYNINMSTNTNNDI
PMNARNDSYRGIDLINDSLSGAKPIDIYDEVLKRKENELFGTKHPKRWKKDNDGGNVPID
NRTLNTDVSIQIDMDHGKPKKEFTNMDTNVDTPTMDSILYDLERHNEPFYDIYDDDVYYD
VNDDNKTSAHHNNLDVSSKVQIEMDVNTKLAKEKYPISDVWDI
Download sequence
Identical sequences W7F332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]