SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7F4M1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7F4M1
Domain Number 1 Region: 55-481
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.88e-84
Family Duffy binding domain 0.00017
Further Details:      
 
Domain Number 2 Region: 800-1133
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.75e-77
Family Duffy binding domain 0.0000684
Further Details:      
 
Domain Number 3 Region: 1219-1587
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.1e-70
Family Duffy binding domain 0.00017
Further Details:      
 
Domain Number 4 Region: 1613-1664,1705-1774,1812-1914,1977-2144
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.66e-69
Family Duffy binding domain 0.00079
Further Details:      
 
Domain Number 5 Region: 518-672,704-724
Classification Level Classification E-value
Superfamily Duffy binding domain-like 8.11e-31
Family Duffy binding domain 0.0043
Further Details:      
 
Domain Number 6 Region: 2137-2232
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.000000863
Family Duffy binding domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W7F4M1
Sequence length 2237
Comment (tr|W7F4M1|W7F4M1_PLAF8) Uncharacterized protein {ECO:0000313|EMBL:EUR68158.1} KW=Complete proteome OX=57266 OS=Plasmodium falciparum (isolate 7G8). GN=PFBG_04123 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MAPVQGGTQDDAKHVLDKIGQQVHDLVKNAALDRSESALQGILSKATYSRNPSGKETPSD
PCDLNHEYHTNVTVGYDKENPCKNRSDVRFSYTEGAECNKNKISGSNDKEGACAPYRRLH
LCDQHLENINDYKNINNHTLLTDVCLAAKFEAESLKTYRAQYQEKYGDVGSTICTVLARS
FADIGDIVRGRDLYRGNNKEKEKLENNLKTIFKKIYDKLLEDNKTNGKNVALQARYQDDA
DNNYFQLREDWWALNRKEVWKAITCGAAGGKYFRNTCVVGNETESNCRCKTNDVPTYFDY
VPQYLRWFEEWAEDFCRKKKKYVDMVKTNCGGKDGKERYCDRDGFDCEKTIRAIFKYARG
ENCHNCIVWCGFYENWIENQKKEFLKQKKKYETEIPVNGRKRRSSPSTEDYEGYEKQFYE
EFKRDYGTVDKFLEILSKEEVCTKITEDDEKINFKTADNSLDKNINNKGTFYHSKYCEIC
PECGVKRKSDGQFVNRTNKDEECKEKEEEYNIPPGVNETKINVLYSGKGRGDITEKLKEF
CEKPHKEDGEKNEQWECYYKDSNDNKCRMKKAGANDKNHAKIMSFNDFFNFWVGHVLTDA
QGWRTQLTKCLSEDKLKKCEKGCKSNCECFKKWIEKKEQEWIKVKQQFNDQPDFGVWKHY
LVLKTILEEYYFENIQKAYGDLKSIQEMKKMIEENQNNPNRSKGDVDALDVLFDHELEEA
EDCLDIHEDDDDADECVEESEKIPNNPCSGTRHRGMVKNVAADMYRAARQQLAIRAGGRK
TLRADASKGTYKKKSKPSDLKENICNINTTHSNDSRNGNNGEPCHGKDKPGVRFEIGTPW
KGGTDVKTSYKEVFLPPRREHMCTSNLEKLDVSWVTKDGKASHSLLGDVLLAAKMDADEI
ITRYKSQNNIEDVTDPKDNETVCRALRYSFADLGDIIRGRDLWDDNNDAKSLQTNLKAIF
KKIKEKHPGIEGNNKYVKDNENKQLRSDWWTANRRQVWRAMKCALKGEKINCGATPHDDY
IPQRLRWMTEWAEWYCKMQSQEYETLQKQCGKCTGTNKHNCTRDNDDCSTCKNACDKYKE
EINKWKKQWEKISGKYLILYLEAQRNSPGTVIGDPNDQQVVDFLTPIHKASIAARNRVKR
AADSPTEITALTPITPYFTAAGYIHQELPHMECQVQNQFCKKKNGVTQPTGEDNTDPLYT
FKQPPPEYKDACGCEGRNKPVSEEKDACEIVEGILAGKKGNQQVGECNPKDQVQPYPGWD
CKKNIDNSHSGACMPPRRQKLCLYYIAHESQTKNINKEEDLRDAFIRTAAAETFISWQYY
KIKNGADAKQLDNGTIPEEFLRSMYFTYGDYRDLCLDTDISKKEKDVGTAKTKIDTIFRK
PKEISPSGEKTTPKDWWQTYGKDIWKGMICALTHGVTNTEEKTKIRTTYSYENLNQTKEG
ITPLENFAEKPQFLRWMIEWGEEFCRERKKLEDKVNTECNGTNATNPCNNGTPCKNACDE
YKNYVETKQKEFRGQTDKFVKDANGENSDAEYKDYKLKEGSSPIQGNDYLINNCDNKKCS
CMEKGMLGDFATDKPFGKYAYDKVKKCNCYQGKPSRSPPPSPPVQPQPEAPQEPGPPEKK
DDVNVCKTVEEALKGKLDDACNQKYAKNNSRLGWRCVAPSGPTSGDQKATPPSNSGATTA
PAPTLPSPVGDSSPSPADSANSVSSAVCIPPRRRRLYVKKIHDWAETVGDKGESKSLETS
DQKTPVSGGNTDALRDAFIQSAAIETFFLWHRYKQLNGKDKTSQGGLPVESQLQQPRSGS
DDSDPQTQLKRGKIPPDFLRLMFYTLGDYRDLCVGKTPDGIDTVSASDSGDNKSSKNPMQ
EISDKIKTILNPDNNKPSVPPNSDKDLGKLRAQWWDTNAQHIWHGMIYALTYKEDTSSGD
KPTQDPTVRTKLWDDNTKKPKPKTDGTNGKDYTYGGVRLEDENSGTQALSPGTSGEKTTL
DSFIKRPPYFRYLEEWGQNFCKERKKRLEKIEEECMDGSDKKCSGYGEDCKNNLPENPST
FKDLEYPTCAKYCRFYRKWIGRKKDEYDKQEKAYGEQQKKGAQGNSGIYDEKFVKKLDSD
YKNIKSFLQKLVSCSKNDSGKDNEKIFEDTEQTFKDAENCKPCSEFKINCKKAKCSGANG
NNCNGGKISPNDIKDDNYPNGNIEMLVSDDSANGFKDGLQQACGGAGIFKGIRKDEWTCE
KLMKNTLYKLEHCLNDG
Download sequence
Identical sequences W7F4M1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]