SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7F515 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7F515
Domain Number 1 Region: 62-289,317-366,389-500
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.32e-83
Family Duffy binding domain 0.00031
Further Details:      
 
Domain Number 2 Region: 931-1267
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.83e-78
Family Duffy binding domain 0.0000738
Further Details:      
 
Domain Number 3 Region: 1748-1828,1870-2143
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.57e-74
Family Duffy binding domain 0.00019
Further Details:      
 
Domain Number 4 Region: 1344-1717
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.72e-73
Family Duffy binding domain 0.00018
Further Details:      
 
Domain Number 5 Region: 2455-2787
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.57e-48
Family Duffy binding domain 0.00031
Further Details:      
 
Domain Number 6 Region: 2820-3105
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.32e-43
Family Duffy binding domain 0.00026
Further Details:      
 
Domain Number 7 Region: 2146-2353
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.83e-33
Family Duffy binding domain 0.0032
Further Details:      
 
Domain Number 8 Region: 514-557,614-737,802-822
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.1e-30
Family Duffy binding domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W7F515
Sequence length 3364
Comment (tr|W7F515|W7F515_PLAF8) Uncharacterized protein {ECO:0000313|EMBL:EUR69477.1} KW=Complete proteome OX=57266 OS=Plasmodium falciparum (isolate 7G8). GN=PFBG_03691 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MAPQGVSGGGGGGGVDKDGIDERSAKHLLDSIGKKVHDEVEKDAKTYEGELKGELQEAAS
TIPELVEFSDTCKLVQEYYNHPNGGDAGGGKGERYPCKKLSGEMGVNRFSDKIGGQCTNE
KMRSDGKGACAPFRRLHLCDHNLEKMGTTKIDNTHKLLLEVCMAAKYEGNSIETYYTPYQ
RTNEDSASQLCTVLARSFADIGDIVRGRDLFHGNPQEKEKRDELEKNLKTIFEKIHSGLT
TTKTKTKKSAKDHYKDENDPNFFKLREDWWTANRHTVWEALTCDVKSGNNYFRPTCSDSG
DGKGQYQANNKCTCNNGDVPTYFDYVPQFLRWFEEWAEDFCRLRKRKLEDAKEQCRPVKN
GEHKYCDLNRYDCTKTASGEKKFVEDDVCKGCQYSCAHFVKWIDNQKLEFLKQKQKYKKE
MEKYTKEITRGGGRKKRGAGSSGDSINGFLELLNKETTCTKNGVIEDGGNIDFKTVNSSS
ASDDGSNKTFYRTTYCEACPWCGAEKGEDEKWKAKTETCGIGKDYTKYKETTTIEILTGD
KGQLDMVRKYKKFCASVNGKNGATPNVNGGGSGSVPSGKGTGGGDSGVAANSTTPGTANG
GAQGGKGKNGASGKNGDNITETWTCYYDENKEKMYGSEEINFCVLQDDKVRTSKEKSMHY
NAFFWKWVYHMLHDSLDWRKQLGSCIDNDKSGQCKNVCKKKCECFESWVKQKKEQEWTQI
KEHFKKQNIGALTRCNPFVTLEYLFMDGDLLKNIEDTHADVKEDEIKNIREMLKETVLDG
PAAASGIDGVGRYKCTEGDNGKHNTKIDKFLDHEKGIANTCVKNNPTDKCEDTPGVRSID
PDSDEDFSEDEEPPPEEVENPCATPSGSTYPVLAEKVAKEMQETAHQKMIENSVKNSVVH
GKGKSGESKSSLIGDISKAQFKDGTKANGLTEDVCDITDQHSNDDRSQGEPCHGKDRGNG
GERMKIGTEWSHIKEKEMSYKEVYLPPRRQHMCTSNLEHLETGQSPLKNSDGKVVNNSFL
GDVLLSAKYEAKKIMELYEKSNEQNETKNQETLCRAVRYSFADLGDIIRGRDMWDEDSGA
KHMENNFKKIFEKIKKHPEIQGKYNTDGPPYKKLREDWWEANRRQVWNAMTCPTKNGIIC
PGMPVDDYIPQRLRWMTEWAEWFCKMQSQEYDTLQKACKECKAKGDGKDCTQKDNDCEPC
KQACDNYKKVVGEWEKQWNNMLVQYLMLDYGANTTAPYGINSYVGAVGDKDKPVVEFFKE
LQKEIKNSDSKRPKRSTDGTTTDPIFTSPYSSAEGYIHQEMGPHMECKEQNVFCPSGGSK
YAFKEPPKGYEDACSCNTRDKTSEAPVTKKEVDACKIVEEILKGKDKNSSIEDCKQKYYP
NKDSYPKWDCENNIDTNHTGACMPPRRQKLCIHNLEHLSEKATETELRKAFIQCAAIETF
WLWDKYKEDKKKDAGGEQKSSDVEAQNQLESGTIPEEFKRQMFYTFCDYRDLCVGTDISS
KGNKGSGVGKVEKNIDKIFTKKGEQNDTKRKEFWNKYAQHIWDAMVCSLTYVGGNKETLT
TNPSYKYNNVKFSGDNSPTLEKFAQTPQFLRWFTEWSDEFCAQREEKEKMVENDCGNAND
HDGCNNKAGKCSKACEAYEDYIKKKNKEYTKQEEKFNTDRNNKKEGYENYSNKKASEYLK
DKCFPDRCNCIEKVNSITDYWNNAFKTYEKDSLQKKCECERPPPDACTIVKDLFEDNSEK
KKYFDQACSLKYSHGKEKHTQWKCINDTTSSHSGKETTSSTSTCIPPRRQKMYTKPIETL
NKMSPLDLRTAFIQSAAVETFFAWHKFIKEKEKEIKEKKKQENGGFYILRIKEEDILSDQ
DHPQNKLKKGNIPDDFMRQMYRTFGDYRDILIGKDMGSNTSDVESKIKGVFRNTEQLPSG
NFDDKRKQFWDKYGKDIWDGMVCALQYDSNDKTIKIHKEVLDKLNNNNKYDKQKSKMEEI
TCRPQFIRWFEEWAEQFCRKKTHKLAQIKEDCRGASGHNYCDGDGFDCKNIVPNKDAIFE
DFNCFSCAKSCNSYKQWINIKRSEFDKQKKIYDKEIHNYESNTDNIYHKFFETRDQNYKS
FDLFLKKLNEGPYCKVNTGDSTIDFKNTEETFAHAKKCAPCPIFGVNCKGEDCNDAEEKK
FKNKNVVGTDDIKNNKDSIKEVVIHVSDKRENKVPKDLEICKGINIFEGITENKWTCGHL
NNSHVCVLENFDGKIDDKRNILFRTLFKQWLENFVKDYNKIKDKISQCTKNSEEYTCIKG
CENKCNCVEKWINNKKLEWGKVRDRYFNQYKMGNSQIYYDVRHFLEIMQPQNEIEKIKGD
FNDLEALETARGCAITTNTGKEERIEKDVVECLLNKLKEKVKTCQRKDDENAPNACEPPG
NIPTSETLDDDQILEEDTPTDKQSPQFCPEHKVVPDKDPKKDELCGKDGNRRPNCNDFKT
YSTSTCEPKKNLIGLNAHNVIASTNLNAYISPRVQQLCLQPLINLTGSLKKSDSVTGDKF
SEALQQCAYNEAKSLYEYYKGEGKQNIPMNNDVEIHDDIQQHTLEAMKRSYADYGNIVKD
DMLWIYPHRRYIDTLIISVADKFNANHKSSSVYTDDNDEKRLNLWKYVRTNVWKAMLCGY
ENVGGSFDNEDLKCKLPDTENTDQFFRWFVEWVENFCIRRKQELSLLESKCPHNICSNED
EHKKTECKNACQKFEQFLINARTQYKKQVIEYDKLKYFYNYTRKKGAVEFLKDRCNSKCS
CFKDKSDNYSDDVLNNLPNELKYKCNCELSPDNPFNVLNDCPSDNTKNSYCKNYTLENLC
EKSHSNNFYNWKIVHVKNKKNGNEIILVPPRRRHLCRKPFIGQWYYKNKKGEENLKSHIY
TAAYSEGYRLSKLYKKKPENVLEVMKNSFADYGNIIKGDDMLGTDIHKKLNVLLDKSKNP
KTAEAWWDTNKKHIWYAMLCGYQKGSDTEKLDESWCSIPTEDRTDQFLRWIVEWAKEACK
EKNIRENALRKKCNCANQDEKSGLPLLKDSTCTNELEKYLKFNTLVKESLEKLNIQYEKN
KTCLISEKKVEEYIKSQLKKDNCDLSDIKDIYKSKNNSENDLYKEILKKFCSPINFETES
TKKDDFAPVEPPSSHNTSDILTNTIPVGIALALGSIAFLFLKKKTKRLVDLFSSPKYKTL
IEVVLEPSKRDIQNDGIPSSKITDNEWNTLKDEFISQYLQSEQPNDIPNDYSSGDIPFNT
QPNTLYFDKPEEKPFIMSIHDRNLYTGEEYSYNVNMVNNDIPMSDKNGTYTDIDLINDTL
SGNQPIDIYDELLKRKENELFGTNHVKQTSIHSVAKLTNSDPIINQLNLFHTWLDRHRDM
CENY
Download sequence
Identical sequences W7F515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]