SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7F578 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7F578
Domain Number 1 Region: 3-237
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.57e-42
Family Duffy binding domain 0.0000889
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W7F578
Sequence length 1108
Comment (tr|W7F578|W7F578_PLAF8) Uncharacterized protein {ECO:0000313|EMBL:EUR69646.1} KW=Complete proteome OX=57266 OS=Plasmodium falciparum (isolate 7G8). GN=PFBG_03670 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MSNINNKDSSTEWNCKEDVGCVPPRRQNLNMERLDNENEDSVPDFMKKTFYLAAAGEGKK
LREKHDESCDEFCDAWNRSLADYKDIFQGKDMWNDGKYGEAKNHIKNAFGDMNNRKAMLN
EIEKGIKDETFSRENGLDVCKSQCEERSRDDTEDQFLRFFAEWEEEFCDGLNKHEEQLKS
CTKDINCDIKCSNFKDWLETKKDEYDIQSRVFEKKYANDNKSKHLNYLKEGMNKCKVKNP
EMVFKSGFANVAECRNLNVEGAGNKNSNNLKDLDSNSDKDGIVSESYKATKKNGESIMDR
IPKSFNKLFGYFSGSQEEEQKENDVSHRNNYDNILVDKFHRSSLLDKLDDRMFFDELNRD
NIMEEVLSKIPEPIIREAPKYVPKKPVPPQHIPRGDNVPRNIDVNGSKDEYSPETESANS
KIKPTYEENDEDKSKISIETSEIDRDKEPFRISEEKKVVKEDVQELENIEYEFDETFDFF
DEDAKRNIDDIRKDIQSQIMKSVENYNSEKEEFKRNIETQLIESGDGMNAGNYSSALQDN
STEIPTMVLVPGVLTVFLLTIIWVLVYKHSLIDRVHGTGKTKKEEKMKELESEEFPKEKY
NIEDMEETEKENEIEKIMDENKETEQTEEGNTEEFVQEKELNQETLENEIIVDHIKEEED
TRNVKEQESVLEESPIEELPVENNIGKINEEVEEFILNEIPLEEQVPKELPQEEIEEIVV
EELPIDEHLSSEETTVTEEDTFKGQLINEEKPVEEKSVKIVQDGSVTKDVEYKELVNDDV
RDKENFVIEEDPFKGQLINEGLPVEEEFVTKELPVKEESVFEELTEEDQSVTKEIPVEEH
SVFKEVDEIESVTDEIVEEEKSITNELVKEERTALEEIVEQRPDTEEVEETELVNEEVLK
EEGSASEKVVKEEGSASEKIVEEEGSVTEETASEEIVEEEGSVTEESSSEEIVEDEGSVT
EESSSEEIVEEEGSAIEESASEVIVEDEVSASKEIVEDEASVTEEVVEEEGAVSDEVQVT
ESVEDEIINQGIVDEVIVEQEASVTDEIVKEDESVIEEIAVEETVTEVVEETKPMDEEIV
DQGSVVENVEEKKKKNNGRRNRRSRISS
Download sequence
Identical sequences W7F578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]