SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7F6I6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7F6I6
Domain Number 1 Region: 32-123
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.27e-30
Family Chaperone J-domain 0.00025
Further Details:      
 
Domain Number 2 Region: 168-279
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.35e-22
Family PDI-like 0.018
Further Details:      
 
Domain Number 3 Region: 430-518
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000175
Family Thioltransferase 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W7F6I6
Sequence length 540
Comment (tr|W7F6I6|W7F6I6_PLAF8) Uncharacterized protein {ECO:0000313|EMBL:EUR70690.1} KW=Complete proteome OX=57266 OS=Plasmodium falciparum (isolate 7G8). GN=PFBG_03255 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MNVTNVVKRRKKLSYFHSLLLIIFSFFLSCARGMDYYKRLGVKRNATKEDISKAYRQLAK
EYHPDIAPDKEKDFIEIANAYETLSDPEKRKMYDMYGEDYAQGGMGGGSPGGGEHAHGFH
FDQDVVNEIFKQFAGGGGAGASGGRAGNFHFKFTSGGPSFNHFEDEYEDIYKNEVLKINS
KNIESVLNDISFSLIINFYSPTCSHCISFKKKYLKLRKKFDGYITFAVVNCQEENMLCRK
YNVKSLPQLILMRSDKTYETFYGNRTDENLTYFIKNNIPSAIIECNNQKKLDNFLTQNIE
IPKVLFFISHNDNIVMLKALSLEFKKRINIGIIYNTNYSVMKLFKKKNIKTPSLLLVDDI
DSLSGDLTQLKNFDFNILSLKLSHIVAQNRLKNNLYGHVTSYQELTKKKYESGQCHEKDS
QICFFILKLLKKNYKSFDEDIKKVANKFSSDPLKILYINIYQQPYILDSFGLSNNIQYSN
GLILVAFRPKRQKFKVYDGDVNVENVHKFVDNVVSGGIPINQNIKRSLKFVHVEQYDDEL
Download sequence
Identical sequences W7F6I6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]