SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7F7V6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7F7V6
Domain Number 1 Region: 13-104
Classification Level Classification E-value
Superfamily RING/U-box 9.13e-34
Family RING finger domain, C3HC4 0.0000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W7F7V6
Sequence length 107
Comment (tr|W7F7V6|W7F7V6_PLAF8) Uncharacterized protein {ECO:0000313|EMBL:EUR80440.1} KW=Complete proteome OX=57266 OS=Plasmodium falciparum (isolate 7G8). GN=PFBG_00446 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MADNITNDKRDIFKIHKWSAVAAWSWDISVDNCAICRNHIMDLCIECQAKTTDHENDKDK
KIDKEGCTVAWGVCNHAFHLHCISRWIKARQVCPLDNTTWEFQKATD
Download sequence
Identical sequences A0A024VDG3 A0A024WCJ6 A0A024WW68 A0A024XE91 A0A060RT59 A0A0L0CXZ7 A0A0L1IEJ7 A0A0L7K7P8 O77367 W4INJ6 W4IQ72 W7F7V6 W7FQC7 W7JV07 W7KCD4
5833.PFC0845c-1 gi|124505039|ref|XP_001351261.1| gi|7768298|emb|CAB11123.3| PFHG_00876T0 XP_001351261.1.26446 XP_012761262.1.2076 PFC0845c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]