SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7F899 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7F899
Domain Number 1 Region: 236-572
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.14e-78
Family Duffy binding domain 0.0000738
Further Details:      
 
Domain Number 2 Region: 1392-1782
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.36e-78
Family Duffy binding domain 0.0000455
Further Details:      
 
Domain Number 3 Region: 649-754,788-889,924-967,997-1098
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.35e-75
Family Duffy binding domain 0.00026
Further Details:      
 
Domain Number 4 Region: 1864-2212
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.22e-62
Family Duffy binding domain 0.00016
Further Details:      
 
Domain Number 5 Region: 1091-1295
Classification Level Classification E-value
Superfamily Duffy binding domain-like 8.5e-26
Family Duffy binding domain 0.0028
Further Details:      
 
Domain Number 6 Region: 4-42,107-127
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.00000000068
Family Duffy binding domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W7F899
Sequence length 2433
Comment (tr|W7F899|W7F899_PLAF8) Uncharacterized protein {ECO:0000313|EMBL:EUR67446.1} KW=Complete proteome OX=57266 OS=Plasmodium falciparum (isolate 7G8). GN=PFBG_04126 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MYVKKKCECFESWVKQKKEQEWTQIKEHFKKQNIGALTRCNPFVTLEYLFMDGDLLKNIE
DTHADVKEDEIKNIREMLKETVLDGPAAASGIDGVGRYKCTEGDNGKHNTKIDKFLDHEK
GIANTCVKNNPTDKCEDTPGVRSIDPDSDEDFSEDEEPPPEEVENPCATPSGSTYPVLAE
KVAKEMQETAHQKMIENSVKNSVVHGKGKSGESKSSLIGDISKAQFKDGTKANGLTEDVC
DITDQHSNDDRSQGEPCHGKDRGNGGERMKIGTEWSHIKEKEMSYKEVYLPPRRQHMCTS
NLEHLETGQSPLKNSDGKVVNNSFLGDVLLSAKYEAKKIMELYEKSNEQNETKNQETLCR
AVRYSFADLGDIIRGRDMWDEDSGAKHMENNFKKIFEKIKKHPEIQGKYNTDGPPYKKLR
EDWWEANRRQVWNAMTCPTKNGIICPGMPVDDYIPQRLRWMTEWAEWFCKMQSQEYDTLQ
KACKECKAKGDGKDCTQKDNDCEPCKQACDNYKKVVGEWEKQWNNMLVQYLMLDYGANTT
APYGINSYVGAVGDKDKPVVEFFKELQKEIKNSDSKRPKRSTDGTTTDPIFTSPYSSAEG
YIHQEMGPHMECKEQNVFCPSGGSKYAFKEPPKGYEDACSCNTRDKTSEAPVTKKEDDAC
EIVKKLLENQESPEYKEACQLKYKGKKEKHTNWKCTTNKTKKGQEDDVCIPPRRQKLYLG
NLEKLNGEKSQQELRTAFIKAAAMETFFLWHRYKEEKKPPAQEGAVGLLPINRTLGDDKD
PQSKLLNGEIPPEFLRQMFYTLGDYRDILVRGGHKDGSGKEIVVHTSGNKQDMDKIQKKI
DEILNNQSGNNKGTSDTQQQTERDKREKWWTNNARRIWEGMLFSLTYDIMGKSMNIDVYT
KLTSTKSTNYKYENVIFSGGLNGNTKLEEFSRRPTFFRWLQEWGEEFCTKRTDKLKKVKD
KCQGFNTNNYKIYCSGDGYDCTEKELKHNKMFTDINCLDCEKECTNYKKWIQKKVEEFYK
QKSKYPSEHGNLSTCYKDDCDQKFYKEIKKTDYSSIHKFLELLNHCKNDGDNSDQDNKID
FTRPLKTFSPSTYCKTCPLSGVNCRGNICNNVQGNKLTWENVFNGKYEAINGTTNIDVEM
VDRRGINIDKKFEQLFKKSCLFKSVRDQKWKCTFINENIDVCKLDNFNNDIDINEYITFK
ILLEHWLQDFIEGYYILNKKIEQCTKGENSVIERCTNKCECVKIWIEKKEKEWNQIKTHF
NKRERDDRFNMAFKVQNFFEKNESILKKFIHNYDDLKNKDEYEDYINDGTCGPNNKGIKK
DMVSFLLSEIKEKIHNANGKPGEPQPNCDEIPPHSDETLDEQTDTTTDDDNSDKIYDTKP
PFCPKDVEDTKETEKPKVLPGPPDACKIVKELLKDKGETDDIDGCKQKEDKKNPYPSWKC
DENMFENNEDGPCMPPRRQKLCIHDLKVLTNTSSEKQLREAFIKCAAKEVYWLWKKYKED
KVKEKPKGVTEVHAGDPQQKLEIGTIPDDFKRMMFYTYGDYRDFLFGTDISRKNANSDLE
KVKNNIDNVFINDPQTKNTERQDWWKIYGKDIWEGMVCGLSHHIKEAEREKFTNSEAYKY
STVSSRLEDFASRPQFLRWFTEWADQFCRERVVKFEELKEKCETVNCNNKDEGNQRIKEE
CEKECKKYEEWLQGWKDQYKKQSAKFDKDKKAGNYEHTSAQEDVDVSSAHDYLHEQLEKL
CINGDCKCMENSSIQDDETDLPGKNDLPEALDNPPKEFEEKCECSEHSEAMSCVEKTAQK
LRKDAEKNVKNYESSLKGNGKNYNGTCNLIEKQNSTNGEYSCEFEKLYPNAIKSLNVSCD
NNGKERFKIEEEWKCDGHTADGKNKLCIPPRRKYMCLKNLENIVSTNISNNNTLLQKIQD
IAKNEGDNIIKNLLPKYPCNENIICDAMKYSFADIGDIIRGRIRIKPNNDNNIEEKLQEI
FTNLKTRNNSFRNIDLTQFREKWWDANRKEVWKAMTCNAPKDAHLKKRINKLGESSQNTD
AKTEKEKCGNDKEPPDYDYIPERHRSLQEWSEYYCKTLIEKNDEMKNKCSECLKNGTCEN
ENNKENCKECIRKCKDYSKFVDKWKAQFEEQNEIYKELYTHARSYGPNAARRDFSIKFIQ
QLDKICEDPNNAEKYLDKSTHCTDYKFSETNNNENDAFSQYPKDFKDKCKCKEKPLPSHL
GKNVISFIQNSFKPPKIPGLKTIQNVVPQIPRTIKNIWPDAHTIHELVARSFDYFVPKFP
KQDKLPPTHNILNDVLPSAIPVGIALALTSIAFLFLKKKTKSSVGNLFQILQIPKSDYDI
PTKLSPNRYIPYTSGKYRGKRYIYLEGDSGTDSGYTDHYSDITSSSESEYEELDINDIYV
PGSPKYKTLIEVVLEPSGNNTTASGTLHYVLKK
Download sequence
Identical sequences W7F899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]