SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7F938 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7F938
Domain Number 1 Region: 239-570,628-646
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.44e-79
Family Duffy binding domain 0.00012
Further Details:      
 
Domain Number 2 Region: 688-763,797-876,907-1080
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.75e-78
Family Duffy binding domain 0.0002
Further Details:      
 
Domain Number 3 Region: 1368-1694
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.88e-72
Family Duffy binding domain 0.0000436
Further Details:      
 
Domain Number 4 Region: 1782-1971,2000-2159
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.53e-63
Family Duffy binding domain 0.0004
Further Details:      
 
Domain Number 5 Region: 1069-1289
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.49e-36
Family Duffy binding domain 0.0039
Further Details:      
 
Domain Number 6 Region: 1-87,128-148
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.01e-21
Family Duffy binding domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W7F938
Sequence length 2528
Comment (tr|W7F938|W7F938_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:EUT70135.1} KW=Complete proteome OX=478859 OS=Plasmodium falciparum Santa Lucia. GN=PFAG_06083 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MLKDSIHWRTKKLDKCINNSNESKACKNNNKCNRECECFQRWITQKKNEWDKIKDHFGKQ
EGIDHVGGLIEFNHDDLLEGVLDKGVLLESLQEGYGNAEDIKHIKELLEEDETKSKAEEA
EAGETDSKKKNTIDWLIQHEEDEADLCLEIHEDEEEGGGDGNTCVEEVEKLRDNPCSGES
GGSGSSSVLRRYPALATKAAQLMHHKAKTQLASRGRRKALRADASKGEYNQKGTASDLKG
DNICNINTRYSNDDRSYGEPCHGKDGDHGGVRMRIGTPWKPGNQINMSDEYAYMPPRREH
MCTSNLEHLNTGNKGLSNSSIASNSLLGDVLLAAKEEAEDIKKNYKERNGQIDNKGICRA
IRYSFADLGDIIRGRDMWDLDEGSKKMEEILKKIFGTLHQSLDDIKNKYTDDDVNHTKLR
KDWWEANRHQVWRAMKCATKNSKIPCHGMPVDDYIPQRLRWMTEWAEWFCKMQSVEYEKL
LTKCGACMRRDGGQCTKNTLVCNKCETECKEYGKNIKKWEKQWEKMSYKYKVLYEAARVD
VDNGKPSAYGDPDYQQVVHFFKELQKEIKNSDSKRPKRSTDGTTTDPTLTSPYSTAAGYI
HQEIGNVGCNVQTQFCEHKNGETPSSGTENKEYAFRSKPYDHDEACSCNTRDKKSEAPVT
KKEDDACEIVKKLFENDVENKKFFDEACRRKYKGGKEKYTQWNCDPKKFRKREKEGACMP
PRRQKLYIQKLEELKDSTPLDQLRTAIIECAAIETFFAWHKYKKDKQSEKKEKEETRGQI
YTPTDENDEAQKELDGGNIPEQFKGQMFYTFGDYRDICLGNDMGNDMGNDMESVNQKMTN
IFQNNSHRTDEQRKQWWEKNGEHIWNGMLCSLSYNTQTKQIKKEVDDKLIKPLNNSTYSY
KTVTFPSTSGPSVNTKLEQFARRPQYFRWLEEWGEEFCRKKNIKIDKIQKDCRGLNGQNY
CDGDGFDCNKMVPNKAKVFDDFHCSSCAKSCSSYNEWISRKKDEFIKQKDRYQTEISDVH
NNNDNEFYTTLKTKYTTATNFVESLKDGACCNDNTENCKIDFNEPKDNFSGSNLCDSCPV
IGVQCKNGDCSKEKKTRCEDKKIIIEDIKKKTESINIDMFVSDNSKGEFANDLSVCQNSG
IFQRIRKDQWSCGNVCGYDVCDLKNFKEGINDKQYILIRTLFKRWVEIFLKDYNKINEKI
SQCMNNGNRSICIEGCEKKCNCIAKWIEKKREEWKMVRDSYLKPYEIKDPQKPYTVKSFL
ESIQPQTELNKAIKPSTNLIHFEDSNKCTHNFTSQKSECENDDVITILIDKLQKKINDCK
DKPNQQIPSNCVQRPPSHISQHSPLGDDETPLDDTTDDIQNPGFCPDEPIAPPAPKEPGV
CERVKSLIGENDGTTEIDGCKRKENYPGWNCAENSFLSGNEGTCMPPRRQKLCIHDLENN
TIENEMKLKEFFINDSAKEIFLLWKYYKETNNNINDRTLEEGTIPEEFFNIMKYTYGDYK
DLLFGTDISNSEGINKVRNHINTVFPQTKGVDARKEWWETNGPKIWEGMLCALTHKISDE
EKKNKIKTTYKDPPHDFAKNPQFLRWFTEWSDKFCRQYKVKKAKLLNKCEKVDCNNKEKH
HETTKQECEKECKEYHEWIKDWKDKYNKQKGKFDKEKKEDKYKNTPAANYIDEEISAHEY
LHEQLEKLCDDGKCSCMENPSTQDDETDLPGQNDLPEALDNPPQEIGDKCECSEPSEPMS
CVEKTAKKLRKNAEKNVEQFLSNLKGKGTNYNDTCNLIKKQNSTNGEYSCEFEKLYPNAI
KSLNVSCDNNGKERFKIGEKWDLVEDTTDVKNKLYIPPRRKDMCLNKWKNIVSTDINDST
KLLEKIQEVAKNEGDDIIKNLLSKYPCNESVICDAMKYSFADIGDIIRGRSKIKPNNGDN
IEGELQNIFRKIQNNTTSLKSIELTQFREKWWDANRKEIWKAMTCSAPKDAHLKKKLNNP
GDNSQNAHPITTPQEKCGYDREPPDYDYIPERYRFLQEWSEYYCKALKEKNNEMKKDCSS
CKKNDKCENDKNDNTCEECKKKCEDYTKFVDKWKAQFEEQNEIYKKLYTQDRTHGTSTAR
RNPSIKFTQKLEESCKNPYSADEYLDKSTHCTDYKFSETNSNKIDYAFSPYPKEYKDKCK
CKEKSENNASPGDTRSLPPQWFLPKIPGLNTIEKAVPRIAKRIKNIWPDAHTIHELVART
FTYFVPFFQTDDKTPPTHNILNDVLPSAIPVGIALALGSIAFLFIKKKTKSTIDLLRVIN
IPKSDYDIPTLKSKNRYIPYRNDFISNMLQGEPKDVPNDYSSGDIPFNTQPNTLYFNKPD
EKPFIMSIHDRNLYSGEEYSYNVNMVNNDIPMSGKNDVYSGIDLINHSLNSNNVDIYDEV
LKRKENELFGTNHPKHISSHNVTKSSNSDPIDNQLDLFHTWLDRHRDMCEKWNNKEELLD
KLKEEWENETHSGNTHTSESNKTLNTDVSIQIDMDNPKTTNEFTYVDSNPNQVDDTYVDM
LYILIIIT
Download sequence
Identical sequences W7F938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]