SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7FC24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7FC24
Domain Number 1 Region: 287-305,336-397,475-499,533-599,650-830
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.81e-75
Family Duffy binding domain 0.0009
Further Details:      
 
Domain Number 2 Region: 826-1042
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.09e-26
Family Duffy binding domain 0.0033
Further Details:      
 
Domain Number 3 Region: 16-124,156-176
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.44e-24
Family Duffy binding domain 0.0033
Further Details:      
 
Weak hits

Sequence:  W7FC24
Domain Number - Region: 1409-1453
Classification Level Classification E-value
Superfamily Adhesin YadA, collagen-binding domain 0.0549
Family Adhesin YadA, collagen-binding domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W7FC24
Sequence length 1661
Comment (tr|W7FC24|W7FC24_PLAF8) Uncharacterized protein {ECO:0000313|EMBL:EUR46808.1} KW=Complete proteome OX=57266 OS=Plasmodium falciparum (isolate 7G8). GN=PFBG_06290 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
LQKDGQDVGKDDKLKGAGGLCILEKTNSEENGKKQKTFNNFFNFWVAHVLKDSIEWREKL
GKCLENGTKTCKNKQCRKNCECYESWIQQKEDEWKLIEQHYEKEDFHDWDPYWALEYNLQ
DDYFPSIQKAYPRVKFVEEIEQIIDENKANISNCTKDNNSITKLLKKEEVIATNCLQKCQ
ETQKPPAGGDAGGRSLTPAGGATDSGGGHSSEDVEDEEDDDDDDDEDGDENEEDEDKDEV
AVEGEDTDGESGPKVVEPEVTKVDGVKPACDIVAELFEKPKDFKEVACKQKYGLPQRYWG
WKCIPSGDNSTTREGSESAGRSRRDTGSSGKPTSDKGSICVPPRRRRLYVKKLHNWATAL
PQGEGAASTETPQVALLRDAFIQSAAIETFFLWDRYKKIKEKERQEKEKREREERALLLP
FASQASGIQVLDQNRVAPQLPPSLPASLGQAQPTPLTQQPVASSDGDPPTSLQKGHIPPD
FLRQMFYTLADYRDILVRGGGNNTNISGSSDKDRPSSNNNNIVLLASENRGEMEKIQEQL
KVFFSNSGNQSSTGGRNPLQNGDTSPQNSDKRQTLWQNIAKDIWNAMVCALTYKDNTNGG
PPTQDEEVKKALLDNDGKPQNSDYTYDKVELKDNDENGGPSPKPQSTSTSGDNTPLTQFV
ERPPYFRYLEEWGETFCRQRTRMLKNVKKACREKHDGGDTFCSGDGHDCTDVERRYNNMF
ADINCRDCYEQCRKYRKWIDMKFEEFQKQKDKYKGELDKLTKDKSGGGDNNCCKEIKNHS
SAADFLKSLRHCKDDEVHEEKGDEYQKNKIDFKNITQTFSPSTYCKVCPLYGVNCNANKR
GKSGTNGCTTNTEPTNQKSAEGVATPITILINDGATDGSTDVTDKQLEEKCKEYGLYKDL
RKQEWNCEHNNNIYKCELQKPLNSEYYDDKIPFNILFQRWLIDFIQYYNKSKERITRCTN
NVTSCKEGCNNKCNCVKKWLEKKEQEWNIIKKYYKERLQSDDERIASRIKSFFEQGTFPS
DVTKAKKVVKCKDEQDKLWGCTGETECKNEQEEKEHADFITNLISKLKEKISECTSQPSD
KTQANCGEYTPPDDEDLLLEEEYPENTLEQPKFCPTPTQPPEEKGGETCGNKEEKKDEKK
EESEEDGVPAAETPDTGPPAPKQPQRPRRPRRTLELLDNPPLKTALVTSTLAWSVGIAFT
ALSYWLLKKKTKRLVDLFSVIDIPKGEYGMPILKSSNRYIPYASGKYKGKTYLYVEGDSS
GDEKYAFMSDTTDITSSESEYEEIDINDIYVPSTPKYKTLIEVVLEPSGKTQSGNNIPSG
DINSGDHIPSDNTPTPSPINDDEWNELKHDFISNMLQNIQPNDYRSGNIPLNTHPTTSRH
NMEEKPFIMSIHDRNLLNGEEYSYDMSTNSGNNDLYSGNNDLYSGNNDLYSGNNDLYSGK
NNLYSDVDSTSDNRGPTSDTKDPISDKNGPYSGIDLINDSLSFDYDIYDEILKRKENELF
GTNHHTKHTSTHNVAKNTNSDPITNQLEMFHKWLDRHRNMCQQWDNTVDILNKLKEEWDS
DKLHTPIDDIPSDNKTLNTDVSIQIHMDNPKPTNEDNVVDCNPVENNIYVDSNPDRTFPS
NPNLVENNTYVNTPTNVQIEMDVNNHKVVKEIYPISDMWDI
Download sequence
Identical sequences W7FC24

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]