SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7FC61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7FC61
Domain Number 1 Region: 194-533
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.54e-75
Family Duffy binding domain 0.0000826
Further Details:      
 
Domain Number 2 Region: 583-633,661-686,754-776,813-921,978-1157
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.44e-73
Family Duffy binding domain 0.0012
Further Details:      
 
Domain Number 3 Region: 1140-1378
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.19e-38
Family Duffy binding domain 0.0044
Further Details:      
 
Domain Number 4 Region: 1-111,164-184
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.57e-18
Family Duffy binding domain 0.0083
Further Details:      
 
Weak hits

Sequence:  W7FC61
Domain Number - Region: 703-756
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0732
Family beta-sandwich domain of Sec23/24 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W7FC61
Sequence length 1544
Comment (tr|W7FC61|W7FC61_PLAF8) Uncharacterized protein {ECO:0000313|EMBL:EUR48338.1} KW=Complete proteome OX=57266 OS=Plasmodium falciparum (isolate 7G8). GN=PFBG_06154 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MTEWAEWFCKAQAEAYGELLRDCGSCKIKGQGCTSSDPKCTPCSNQCNEYRKKIKEWHEQ
WDKMDMKYLTLYLEVLNTARNGGTHTYSGAVGEKDKPVVAFLQELQEANKSSTSKRPKRS
TDGTNTDPTLTSPYSSAAGYIHQELPYTQCEEQKHFCTSVDKENKDKYVFREKPKDHDEA
CGCKSRPKPEKKTGKKKEEEDPECKTVNDILKGNDGNRKVGDCHPKKNSNGYPDWQCDQQ
SGLVTEDGICMPPRRQKLCLYYLTQLGDNEKEDKLREAFIKTAAAETFLAWQYYKSKHGN
DAHTLDEQLKKGKIPPEFLRSMYYTYGDYRDICLDTDISKKEKDVGTAKTKIDNIFKNGK
LDGLSRQEWWKTNGPEIWKGMICALTHGVTNTDNKTKIKTDYSYKELNQSKNGNPSLEEF
AAKPQFLRWFIEWGEEFCVERQKKEDTVNSECSGKNATNRCDSGTPCKEACEKYEQYVNK
KKNEFNKQNNKFVRNANLKNADQEYNDYKLKEGKGPSKQGNDYLKDKCDNNKCSCMQGNV
LSVLPTDKPFGKYAYDKVKKCNCLHGKYSPEELQPPAQQPQGPPVIPAPVVDVCNTVDKL
FKDVTTLTNACPTKYGKTAPSSWKCVASGEKSGAGATTATASPLTSPEAGASANSANSVS
SAVCIPPRRRKLYIQKLQEWAKNYNTDKSQVDGKAEGGGTGKQSSQLQQQEQQEQQQQQQ
LQQLQPQSQSTVAVSQTSNGETTLPPSSHLRDADGLRDAFIQSAAVETFFLWHKYKEEKK
PPATQNAGAAALPLSLLETSPPSENPQTKLNGGEIPNDFLRLMFYTLGDYRDILYSGSKD
AKNGFNYIFSGDKEMEQRESKIQEQLKVFFSNSGNQSSTGTSRGPSSVKTGSNSGKDPAS
WWNTHGPDIWNGMICALTYKENEEKGKTTITEDGTLKDKLLDTTGKPKNGNDYNSVTLKD
ESSDTNPQTPSSSGDNTPTTLTNFISRPPYFRYLEEWGETFCKERKKRLDQIYEECKVGE
NDRKNGNKKCSGYGENCDDQLEDEPTNFKDLWCQDCGKSCSSYRKWIERKKDEFEQQEKI
YNEQKTKYQKQSETAKEFCATLNTYSKAGDFLERLKNGPCSKTYNENDNGKDNQEDEINF
NDPEQTFKHTKYCDPCSQFKIDCTKAKCTVDEKTVKCKKNGSAYITASDIENGGNSTHKL
DMRVSDNGATEFYGLKDCEGKSIFEGIRNEQWKCGNVCGYVVCKPENGNGKNVSGKANSE
KQFITIRALLHRWLEYFLEDYNKIKHKISHCINNGEGNICKKDCQNKCNCVEKWVEKKKL
EWKEIKNRLVEQYKNTTSSSINFNVKSSLEKFEHRPEFQNAIKPCNGLEKFQNSTDCTVA
GSSENGKKRDVVECLLDKLEKEAKKCKSQPSANDCTTTPTAFEDDDDYIPIEENTVEQPN
ICPTVEEKKEIVDEGKCEAAPTAPKAPEPAPPSSSAEETPVLKPEEEAPTPESPKKEKPS
KPKPVAPKPWEITLSTPLKNAMLSSTIMWSIGIGFATFTYFYLK
Download sequence
Identical sequences W7FC61

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]