SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7FC68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7FC68
Domain Number 1 Region: 787-805,844-915,945-1050,1113-1280
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.59e-76
Family Duffy binding domain 0.0006
Further Details:      
 
Domain Number 2 Region: 267-594,641-659
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.62e-75
Family Duffy binding domain 0.00019
Further Details:      
 
Domain Number 3 Region: 1274-1491
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.35e-39
Family Duffy binding domain 0.0019
Further Details:      
 
Domain Number 4 Region: 2-103,173-193
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.45e-26
Family Duffy binding domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W7FC68
Sequence length 2121
Comment (tr|W7FC68|W7FC68_PLAF8) Uncharacterized protein {ECO:0000313|EMBL:EUR69334.1} KW=Complete proteome OX=57266 OS=Plasmodium falciparum (isolate 7G8). GN=PFBG_03887 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MSYNAFFWDWVYRMLHDSLDWRNELGSCINDAKSGQCENKCNSKCGCFLKWVNEKKTEWT
NIKEHFLKQDDIVQQTGCNPIVTLAALLDIDLLLKSIKDTHVDANDIDRIKKMLEQAGFD
GVAAVGSFGAGAGGTFSGLRAGGWFSVPSLGAGGAGGAGGAGSYKCTEGAKGKHNTKIDK
FLQEEEQFAETCKQIQEECQPKKPTKVRNPCYGNNTYDALAHKVAADIHKKSHEDMLDRS
GDKGESKLKADASKGHYNGNGNVKNLNGEICSIDEKYSNAESNKSKDPCNNKGVRFKIEE
VWKNARENGKVIGVYLPPRREHMCTSNVEHLSSSKGGRFKKVPNGKASHSLLGDVLIAAK
KEGEDIKNKLTQNGNRSSICRTMKYSFADIGDIIRGRDLWEHKDQTELQGHLKTIFDKIK
TELEDNLNGKYATDDPKHTKLRADWWEANRYQVWNAMKCATKNGNIQCGATPYDDYIPQR
LRWMVEWAEWYCKAQKKEYDKLFMQCAKCMGNGQGCTSGDSEVCKQCKAACTSYRDKIKE
WEKQWEVISYKYLMLYYGAKTTAAYGTVAYSGDVEPEDKPVVAFLQELLPQKNGKPADTP
TPYETAEGYIHQEIGNAGCNVQTQFCEKKNGDNPTNGEEKVDNEKYAFRHPPHDHDDACE
CKPPQQENPGRSRGTTPHAGSDEGDEHSEGSEDEEEEEEEEEEEEEKKEEEEKKEEEEKK
EEEEKKEEEEKKEEDTPKDTTVNGDGSAPKEAEVPAATTEKKEEVNPCDIVNTLFTTGDA
KTNFKDACEQKYAKNNSRLGWKCIPSGDKTAAGGGGEPTGERAEPTRAKREAPSGAVPTT
SDGSGSICVPPRRRKLYVGKLHDWAEKTQLQTQVGESPLDSTSPTSSGSPNGDPLLAAFV
ESAAIETFFLWHKYKKEWELQKKAELPQPGAGSDDNNPENQLASGTIPLPFLRQMFYTLA
DYKDILYSGNKDKKNGYNDILRGDKEMEQRESKIQQKLKTFFSNSGDKPSTGTSTGSSSV
KNPESWWQKNGEHIWNAMVCALTYKENSSGGEKTTTISQDGDLKDKLWDDNTKKPKPPQY
EYKTVELKEENSVTDGPKAFTSEPPSASGNTPTLNNPKLTQFVVRPPYFRYLEEWGQNFC
KERKKRLKQIKVECTKDGDTQKYSGDGEDCNEIHNEDPTIFKDLENASCANSCRLYKKWI
DIKKIQYEKQKKEYSEQKDKAKNNNGFYERLKTYTEAKDFLQKLGPCSKNNSGDDKKGED
EIKFDDDKTFQHAKNCDPCSQFRVKCENGKCKNGGGGTNETCNGKIKTITAENINNSTED
IGMVVSDDSKSGSGFKGNGLEACQYAGIFKGIRKDEWKCDKVCGYFLCKPEKGNGKNEGT
YIIQIRALFKRWVENFLEDYKKITHKISHCKENDEKNICKKDCKDKCTCVDKWIKLKQQE
WEIIKERFNEQYNDDNPDKYFNVKSFLEKFQDLTEFKNAIKPCGDLNAFKKSCGLNGTDS
SQKKNTHERDIVECLLKKLKDKANKCKDQPSGSKQCTTPPTTLEEEEYPENTLEQPKFCP
TTTQPPEEKGGETCGNKEEKKDEKKEESEEPAKEESGPAAEEPAANSSPSSESSEETDQK
PEAPPPKPAPDPPKPQRPRRPRRTPELLDNPPFKTALMSSTIMWSIGIGFAAFTYFFLKK
KTKASVGNLFQILQIPKSDYDIPTLKSSNRYIPYVSDTYKGKTYIYMEGDSDEDKYTFMS
DTTDVTSSESEYEELDINDIYVPGSPKYKTLIEVVLEPSGNNTTASGKNTPSDTQNDIQN
DDIPTSKITDNEWNKLKHDFISNMLQNQPKDVPNDYSSGDIPFNTQPNTLYFDNNQEKPF
ITSIHDRNLYTGEEYSYNVNMVNNDNIPINRDNNPYSGIDLINDSLNSNKVDIYDELLKR
KENELFGTEHHPKHTNIYNVAKPARDDPITNQINLFHKWLDRHRDMCEKWDTNNKVDILN
QLKEEWENDNSNSGNKTSGNITPTSDIPSGKLSDIPSTNKMLNSDVSIQIHIDKPNQVDD
NIYLDTYPDKYTVDNINPVDTHTNPNLVGNINPVDQNSNLTFPSNPNPAYDNIYIDHNNE
DLPSKVQIEMSVKNGEMAKEK
Download sequence
Identical sequences W7FC68

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]