SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7FDY4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7FDY4
Domain Number 1 Region: 92-358,387-446
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.54e-62
Family Duffy binding domain 0.00058
Further Details:      
 
Domain Number 2 Region: 1324-1604
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.01e-57
Family Duffy binding domain 0.000062
Further Details:      
 
Domain Number 3 Region: 957-1287
Classification Level Classification E-value
Superfamily Duffy binding domain-like 8.24e-49
Family Duffy binding domain 0.00019
Further Details:      
 
Domain Number 4 Region: 622-864
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.07e-27
Family Duffy binding domain 0.0077
Further Details:      
 
Domain Number 5 Region: 437-507,541-613
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.000000000432
Family Duffy binding domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W7FDY4
Sequence length 1985
Comment (tr|W7FDY4|W7FDY4_PLAF8) Uncharacterized protein {ECO:0000313|EMBL:EUR72619.1} KW=Complete proteome OX=57266 OS=Plasmodium falciparum (isolate 7G8). GN=PFBG_02328 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MALQRDAGGGEDDYKDAKELLDKIGQQVHDEVEKDAETYKGELKGDLKKAKGSEERASSL
KTCDLVKEYYTTRLGDKNERNPCKELSGKMGENPFSDTLGGQCTKEKISGSTSTCGACAP
YRRLHLCSHNLETINNTTPTASDTLLAEVCMAAKYEGDLIKTHYLKHELTNEGTASQLCT
VLARSFADIGDIIRGRDLFLGNTYESAQRDQLDKKLKEIFTQIYNDVTTNGKKPALQKRY
KKDDDPDFLKLREDWWTANRATIWEAITCAAKVGDTYFRATCSDGNSQYQTQNQCRCKKN
DGTNETDQVPTYFDYVPQYLRWFEEWAEDFCHNQKLEFLKQREKYKSEIKKYTNGTTNSK
RKKRSTKIDTYEGYEKKFYNELKKNNYGKVDKFLQKLNDEDICTKNGDIEEEGIINFKNV
KSSSASGDGSNKTFYRTKYCEACPWCGVKKQNGKGGKWEREGDETCGEGKDYNNYKDTQI
PVLTGDKTKGNMVQKYNKFCKNNGKNGATGTAKDGVGGSENGAASGDNSDNATTGYCGTN
NSDKDPSLCEKWTCYYKKNENNDGKGNNDDINFCVQQKQNQDEKNENSMHYNAFFWDWVY
HMLHDSLDWREEKDNDNKIDFGKPLETFRHSKYCEMCPSYEVKCNGSNRRGKNGECTPVN
GNGKTWKEVFEGISGKSSDLTVEMIDRRGPFIEEYMEKKSEKLQKSNDLFKTSRLFKGLR
VQNWKCKVIDNNTDVCKLDKFHQKVDLNEYTTFKVFLEYWLEDFLYGYYILKQKKIIDKC
TENGGNTCNGQPKNYCACVGKWVQQKGKEWESIKDHFKIQNNERGYGIVYTVESLLGNLI
PLMDLANDKGKINELKDFLRLYECKCSDNSKSDKDDTQKDIVQCLLDKLETKATSCQNLH
SDKPGQTCDPFPALEDTSTSPDNDAQMPPFCPKDVEEDKKEPETDSDRLCDDKQEPKCND
FQKYTNSTCEPKKNLIGLGAHNLIASPRSNIYISPRVQQLCLQDLQNLKENNTEKNALID
ALKKCAYNEGKGLYEYYEKNKDTIRKNGSIWTDEELKTYTLQAMKRSYADYGNIVKGDLI
WDYHNDNTVNEIIFAITKKEYISENTNSIYYETKERQNLWKSIRTDVWKAMLCGYKDAVG
DMNSLSNAVDLCKLPSTDEEDQFSRWFKEWGENYCIRREQELKQLKDKCKNGICKITDEA
KKKECERLCEKYGQFLSNSKTQYEKQSIVYNELKTSISEFQNTDPFTFLKDKCNSKYCCF
KNIENTNKGNKIIEYFSDEIKDICDCKKEQESEAQVHDLDKCPIENKNNKICNKYNKRRM
CGEFKYSNSLDNWYGRNMLIPPRRRHLCLRNIIIKKNYRKGDISKFKDDLFYAAASEAKF
LFNNYENKNESLQAIKYTFADIGDIIKGNDMMDDMTYKKIKGKLENVLDKTGNNPDTPEK
WWEENKKHVWKAMLCGYKEAGGKIKPNDCNIPTEENTDQFLRWFQEWTEAFCSRKNELYK
ELEAQSEKAECLDGRIYPDAFKNACEKYRNFIANKKIQYDLQMYQYNKKYNKSQLNSKKV
PDFLKNQCNGKCDCLSENFIKNFKLENPYETLDNEKLKNICDCQKSERIQPLPPADQPFD
PTILHTTIPFGIAFALGSIAFLFLKKKTHSPVDLLRVLDIHKGDYGIPTPKSSNRYIPYA
SDRYKGKTYIYMEGDSDSGHYYEDTTDVTSSESEYEEMDINDIYVPGSPKYKTLIEVVLE
PSGKNTTASGKNTTASGNNTTANEFISQYLQSEQNTEPNMLGYNVDNNTNPKTLHVSMEE
KPFITSIHDRNLLSGEEYNYNVNMVNNDDIPMSDKNGNYTGIDLINDTLSGNHNVDIYDE
VLKRKENELFGTEHHPKRTSTHSVAKNINSDPIHNQLELFHKWLDRHRDMCEKWNNKEEL
LDKLKEEWENETHSGNKHSDIPSGKLSDTPSDNNIHSDIHPSDIPSGKLSDTPSDNNIHM
TYHTC
Download sequence
Identical sequences W7FDY4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]