SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7FFB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7FFB5
Domain Number 1 Region: 430-740
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.92e-69
Family Duffy binding domain 0.0000000000065
Further Details:      
 
Domain Number 2 Region: 153-425
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.42e-56
Family Duffy binding domain 0.0000000000439
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W7FFB5
Sequence length 1475
Comment (tr|W7FFB5|W7FFB5_PLAF8) Erythrocyte-binding antigen 175 {ECO:0000313|EMBL:EUR73586.1} KW=Complete proteome OX=57266 OS=Plasmodium falciparum (isolate 7G8). GN=PFBG_01936 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MKCNISIYFFASFFVLYFAKARNEYDIKENEKFLDVYKEKFNELDKKKYGNVQKTDKKIF
TFIENKLDILNNSKFNKRWKSYGTPDNIDKNMSLINKHNNEEMFNNNYQSFLSTSSLIKQ
NKYVPINAVRVSRILSFLDSRINNGRNTSSNNEVLSSCREKRKGMKWDCKKKNDRSNYVC
IPDRRIQLCIVNLSIIKTYTKETMKDHFIEASKKESQLLLKKNDNKYNSKFCNDLKNSFL
DYGHLAMGNDMDFGGYSTKAENKIQEVFKGAHGKISEHEIKNFRKKWWNEFREKLWEAML
SEHKNNINNCKNIPQEELQITQWIKEWHGEFLLERDNRSKLPKSKCKNNTLYEACEKECI
DPCMKYRDWIIRSKFEWHTLSKEYETQKVSKENAENYLIKISENKNDAKVSLLLNNCDAE
YSKYCDCKHTTTLVKSVLNGNDNTIKEKREHIDLDDFSKFGCDKNSVDTNTKVWECKNPY
ILSTKDVCVPPRRQELCLGNIDRIYDKNLLMIKEHILAIAIYESRILKRKYKNKDDKEVC
KIINKTFADIRDIIGGTDYWNDLSNRKLVGKINTNSKYVHRNKKNDKLFRDEWWKVIKKD
VWNVISWVFKDKTVCKEDDIENIPQFFRWFSEWGDDYCQDKTKMIETLKVECKEKPCEDD
NCKSKCNSYKEWISKKKEEYNKQAKQYQEYQKGNNYKMYSEFKSIKPEVYLKKYSEKCSN
LNFEDEFKEELHSDYKNKCTMCPEVKDVPISIIRNNEQTSQEAVPEENTEIAHRTETPSI
SEGPKGNEQKERDDDSLSKISVSPENSRPETDAKDTSNLLKLKGDVDISMPKAVIGSSPN
DNINVTEQGDNISGVNSKPLSDDVRPDKKELEDQNSDESEETVVNHISKSPSINNGDDSG
SGSATVSESSSSNTGLSIDDDRNGDTFVRTQDTANTEDVIRKENADKDEDEKGADEERHS
TSESLSSPEEKMLTDNEGGNSLNHEEVKEHTSNSDNVQQSGGIVNMNVEKELKDTLENPS
SSLDEGKAHEELSEPNLSSDQDMSNTPGPLDNTSEETTERISNNEYKVNEREDERTLTKE
YEDIVLKSHMNRESDDGELYDENSDLSTVNDESEDAEAKMKGNDTSEMSHNSSQHIESDQ
QKNDMKTVGDLGTTHVQNEISVPVTGEIDEKLRESKESKIHKAEEERLSHTDIHKINPED
RNSNTLHLKDIRNEENERHLTNQNINISQERDLQKHGFHTMNNLHGDGVSERSQINHSHH
GNRQDRGGNSGNVLNMRSNNNNFNNIPSRYNLYDKKLDLDLYENRNDSTTKELIKKLAEI
NKCENEISVKYCDHMIHEEIPLKTCTKEKTRNLCCAVSDYCMSYFTYDSEEYYNCTKREF
DDPSYTCFRKEAFSSMPYYAGAGVLFIILVILGASQAKYQSSEGVMNENNENNFLFEVTD
NLDKLSNMFNQQVQETNINDFSEYHEDINDINFKK
Download sequence
Identical sequences W7FFB5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]