SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7FFL6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7FFL6
Domain Number 1 Region: 333-467,509-602,660-829
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.62e-76
Family Duffy binding domain 0.00081
Further Details:      
 
Domain Number 2 Region: 813-1043
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.98e-40
Family Duffy binding domain 0.0063
Further Details:      
 
Domain Number 3 Region: 2-172,216-236
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.96e-29
Family Duffy binding domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W7FFL6
Sequence length 1192
Comment (tr|W7FFL6|W7FFL6_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:EUT66021.1} KW=Complete proteome OX=478859 OS=Plasmodium falciparum Santa Lucia. GN=PFAG_06138 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MVKKYKKFCNGNGGNGAPGTATSGAPGEKGASGKNGDNITETWECYYKKKEKDGGKDINF
CVQQKQENDGKKEYSMHYNAFFWDWVYHMLHDSLEWRKQLGSCINNNSNGNTCKNKHCKD
DCGCFQKWVVKKKETEWENVKKHFYKQKDLIEEIGEAYIGVTLELLLEKDLLLKSIEDTH
ADAKDIEHIRKMLQKTVFDGADASGTGVSGIGGATGKNTKIDKFLDHEKGEAETCKNCEQ
RKPQPIRPAGRADLGTEENIQTPDEDADSDTNSDNDEEEEEEEEEENVHDGEAEAEDNTH
AEPVDKENVDGAEVETPEKTTEDTGKGSEPVSPPLPPVNVCETVAKALEDTGSLQKACST
KYGSKAPTSWKCIGDSTTKPVSETARSSGEPTGGKDGATGGLCIPPRRRKLYVGKLEQWA
NKHNTETSQGVDAASSTSSPTDATQLLRDAFIQSAAIETFFLWHRYKQLNGKGKDTQGAA
GGLYIQLDASSDTLGDSGDPDPQTQLQSGTIPPDFLRQMFYTLADYKDIFEGKSIEVGDE
KEKEKMKQLQAKIQEHINGGSKPGISSPPPGDKKPGQTRESWWEKNVESIWNGMIYALTY
EDSGAIGQPPTQNGDLKDKLWDNTNKNTPKNPQYKYDKVQLGEEEASGAKPTGGDDPLNN
PKLENFVEIPTFFRWLHEWGNSFCFERAKRLAQIKVDCTQGGDKCSGYGENCEDQLSKNS
YDTVADLECPKCAKHCSFYRKWIERKKDEFTKQGNAYDGQKKKYEEENDSAQKNNGFCET
LTTYTTAAKFLENLGSCKKDSGEGNGRDKLDFSQPNVTFKDADNCNPCSEFKINCKNGKC
SADRKGECNRITTIDADYIKNKTNSTEEVVMRVSDNGESRFENDLSDCNGAGIFKGIKKD
VWKCGKVCGYEVCIPEKGNREKENAKNTIIQIRALVTHWVQNFLEDYNKIRTKLKPCMNN
SDGSPCIDNYDKKYTCVNEWIEKKRTEWKKIKEHYLDKNTHGDRDIKTLVKNILSGLYPQ
TEVLKAIKPCDDLNAFENSIHCNGTAGSKKSEEEKKKGCCSIGEPCDTTPLDDEEPEPLE
ETEENQVKPPEICPKPPEEPKETCEAAVAPNEPEEEKKEKEKEEQEEEEPEVSPPATPKS
LPKKPKKDKKEKSPPKMFELPLSDELNKAMLSSTIMWSIGIGFAAFTYFYLK
Download sequence
Identical sequences W7FFL6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]