SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7FI87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7FI87
Domain Number 1 Region: 203-253,281-306,374-396,433-541,598-777
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.57e-73
Family Duffy binding domain 0.0012
Further Details:      
 
Domain Number 2 Region: 760-998
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.45e-38
Family Duffy binding domain 0.0044
Further Details:      
 
Domain Number 3 Region: 1-153
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.36e-23
Family Duffy binding domain 0.00059
Further Details:      
 
Weak hits

Sequence:  W7FI87
Domain Number - Region: 323-376
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0811
Family beta-sandwich domain of Sec23/24 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W7FI87
Sequence length 1614
Comment (tr|W7FI87|W7FI87_PLAF8) Uncharacterized protein {ECO:0000313|EMBL:EUR74128.1} KW=Complete proteome OX=57266 OS=Plasmodium falciparum (isolate 7G8). GN=PFBG_01729 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MICALTHGVTNTDNKTKIKTDYSYKELNQSKNGNPSLEEFAAKPQFLRWFIEWGEEFCVE
RQKKEDTVNSECSGKNATNRCDSGTPCKEACEKYEQYVNKKKNEFNKQNNKFVRNANLKN
ADQEYNDYKLKEGKGPSKQGNDYLKDKCDNNKCSCMQGNVLSVLPTDKPFGKYAYDKVKK
CNCLHGKYSPEELQPPAQQPQGPPVIPAPVVDVCNTVDKLFKDVTTLTNACPTKYGKTAP
SSWKCVASGEKSGAGATTATASPLTSPEAGASANSANSVSSAVCIPPRRRKLYIQKLQEW
AKNYNTDKSQVDGKAEGGGTGKQSSQLQQQEQQEQQQQQQLQQLQPQSQSTVAVSQTSNG
ETTLPPSSHLRDADGLRDAFIQSAAVETFFLWHKYKEEKKPPATQNAGAAALPLSLLETS
PPSENPQTKLNGGEIPNDFLRLMFYTLGDYRDILYSGSKDAKNGFNYIFSGDKEMEQRES
KIQEQLKVFFSNSGNQSSTGTSRGPSSVKTGSNSGKDPASWWNTHGPDIWNGMICALTYK
ENEEKGKTTITEDGTLKDKLLDTTGKPKNGNDYNSVTLKDESSDTNPQTPSSSGDNTPTT
LTNFISRPPYFRYLEEWGETFCKERKKRLDQIYEECKVGENDRKNGNKKCSGYGENCDDQ
LEDEPTNFKDLWCQDCGKSCSSYRKWIERKKDEFEQQEKIYNEQKTKYQKQSETAKEFCA
TLNTYSKAGDFLERLKNGPCSKTYNENDNGKDNQEDEINFNDPEQTFKHTKYCDPCSQFK
IDCTKAKCTVDEKTVKCKKNGSAYITASDIENGGNSTHKLDMRVSDNGATEFYGLKDCEG
KSIFEGIRNEQWKCGNVCGYVVCKPENGNGKNVSGKANSEKQFITIRALLHRWLEYFLED
YNKIKHKISHCINNGEGNICKKDCQNKCNCVEKWVEKKKLEWKEIKNRLVEQYKNTTSSS
INFNVKSSLEKFEHRPEFQNAIKPCNGLEKFQNSTDCTVAGSSENGKKRDVVECLLDKLE
KEAKKCKSQPSANDCTTTPTAFEDDDDYIPIEENTVEQPNICPTVEEKKEIVDEGKCEAA
PTAPKAPEPAPPSSSAEETPVLKPEEEAPTPESPKKEKPSKPKPVAPKPWEITLSTPLKN
AMLSSTIMWSIGIGFATFTYFYLKKKTKSSVGNLFQILQIPKGDYDIPTLKSSNRYIPYA
SDRYKGKTYIYMEGDSSGDEKYAFMSDTTDVTSSESEYEELDINDMYVPGSPKYKTLIEV
VLEPSKRDTMSTQSDIPLNDKLDSNKLTDEEWNKLKQDFISILQNPQNDLPQNNISGNIQ
MDTHPSVSILHDDMEEKPFITSIHDRDLHNGEEVTYNINLDDHKNMNFSTNHDNIPPKNN
QNDLYTGIDLINDSISGNHNVDIYDELLKRKENELFGTNHTKHTTTNSITKKTHNDPIVN
QINLFHKWLDRHKNMCEQWDKHKKEELLDKLKKEWEQDYNNNSDDIHTSDNNIVSTVNHV
FNTDVSIQIDMDDPNPVNPFTNMYTNSDNSTMDNILNGMEKHREPYFYDIYEDDITYFDI
DDEKTPMGDIYVDHNNVNSNNMDVPNKVHIEMNIVNNKKEIFEEEYPISDIWNI
Download sequence
Identical sequences W7FI87

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]