SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7FKB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7FKB9
Domain Number 1 Region: 409-726
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.09e-48
Family Duffy binding domain 0.0000259
Further Details:      
 
Domain Number 2 Region: 126-400
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.23e-47
Family Duffy binding domain 0.000037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W7FKB9
Sequence length 1493
Comment (tr|W7FKB9|W7FKB9_PLAF8) Uncharacterized protein {ECO:0000313|EMBL:EUR82676.1} KW=Complete proteome OX=57266 OS=Plasmodium falciparum (isolate 7G8). GN=PFBG_00021 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MKGKMNMCLFFFYSILYVVLCTYVLGISEEYLKERPQGLNVETNNNNNNNNNNSNSNDAM
SFVNEVIRFIENEKDDKEDKKVKIISRPVENTLHRYPVSSFLNIKKYGRKGEYLNRNSFV
QRSYIRGCKGKRSTHTWICENKGNNNICIPDRRVQLCITALQDLKNSGSETTDRKLLRDK
VFDSAMYETDLLWNKYGFRGFDDFCDDVKNSYLDYKDVIFGTDLDKNNISKLVEESLKRF
FKKDSSVLNPTAWWRRYGTRLWKTMIQPYAHLGCRKPDENEPQINRWILEWGKYNCRLMK
EKEKLLTGECSVNRKKSDCSTGCNNECYTYRSLINRQRYEVSILGKKYIKVVRYTIFRRK
IVQPDNALDFLKLNCSECKDIDFKPFFEFEYGKYEEKCMCQSYIDLKIQFKNNDICSFNA
QTDTVSSDKRFCLEKKEFKPWQCDKNSFETVHHKGVCVSPRRQGFCLGNLNYLLNDDIYN
VHNSQLLIEIIMASKQEGKLLWKKHGTILDNQNACKYINDSYVDYKDIVIGNDLWNDNNS
IKVQNNLNLIFERNFGYKVGRNKLFKTIKELKNVWWILNRNKVWESMRCGIDEVDQRRKT
CERIDELENMPQFFRWFSQWAHFFCKEKEYWELKLNDKCTGNNGKSLCQDKTCQNVCTNM
NYWTYTRKLAYEIQSVKYDKDRKLFSLAKDKNVTTFLKENAKNCSNIDFTKIFDQLDKLF
KERCSCMDTQVLEVKNKEMLSIDSNSEDATDISEKNGEEELYVNHNSVSVASGNKEIEKS
KDEKQPEKEAKQTNGTLTVRADKDSDRNKGKDTATDTKNSPENLKVQEHGTNGETIKEEP
PKLPESSETLQSQEQLEAEAQKQKQEEEPKKKKKKQEEEQKREQEQKQEQEEEEQKQEEE
QQIQDQSQSGLDQSSKVGVASEQNEISSGQEQNVKSSSPEVVPQETTSENGSSQDTKISS
TEPNENSVVDRATDSMNLDPEKVHNENMSDPNTNTEPDASLKDDKKEVDDAKKELQSTVS
RIESNEQDVQSTPPEDTPTVEGKVGDKAEMLTSPHATDNSESESGLNPTDDIKTTDGVVK
EQEILGGGESATETSKSNLEKPKDVEPSHEISEPVLSGTTGKEESELLKSKSIETKGETD
PRSNDQEDATDDVVENSRDDNNSLSNSVDNQSNVLNREDPIASETEVVSEPEDSSRIITT
EVPSTTVKPPDEKRSEEVGEKEAKEIKVEPVVPRAIGEPMENSVSVQSPPNVEDVEKETL
ISENNGLHNDTHRGNISEKDLIDIHLLRNEAGSTILDDSRRNGEMTEGSESDVGELQEHN
FSTQQKDEKDFDQIASDREKEEIQKLLNIGHEEDEDVLKMDRTEDSMSDGVNSHLYYNNL
SSEEKMEQYNNRDASKDREEILNRSNTNTCSNEHSLKYCQYMERNKYLLETCSEDKRLHL
CCEISDYCLKFFNPKSIEYFDCTQKEFDDPTYNCFRKQRFTSMSCYKIKNNIH
Download sequence
Identical sequences W7FKB9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]