SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7FKJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7FKJ7
Domain Number 1 Region: 236-253,288-352,391-415,449-506,572-749
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.03e-72
Family Duffy binding domain 0.00076
Further Details:      
 
Domain Number 2 Region: 746-972
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.57e-20
Family Duffy binding domain 0.0068
Further Details:      
 
Domain Number 3 Region: 20-74,112-132
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.000012
Family Duffy binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W7FKJ7
Sequence length 1151
Comment (tr|W7FKJ7|W7FKJ7_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:EUT65764.1} KW=Complete proteome OX=478859 OS=Plasmodium falciparum Santa Lucia. GN=PFAG_06145 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MVRKQDVKTIINVKQIVIVFKNGLIKKKNEWEKIVEHFNTQDFGTQGENAEYKMLGTGMT
ADVVLKTVLDLEFANKNTEEDKENNVSAREIDLINEMLEKEKSQEVVGADSKKKNTIDLL
IEHEERIAKECKEKNPEKCEDPPTKPPASDVSRSASPATAATATKKASHEDAEEEDDDDD
DDEDGGGGDTAEGTEEAEAEEDTEQVDTGPPATKDVVNPCDIVKELFSNTTKFSDACTLK
YVTGKNYGWKCIPSGDKTATSDEGAEAKSRHRREADSGEKTTGKSDGSGSICVPPRRRRL
YIGRLTQWAEEATKSLSPQGSTSSPSNPRDGLLKAFVESAAVETFFLWDRYKKEKEIEKK
EKNRADGQIYASTGEDDENKNKDPQTELNDGTIPIDFLRLMFYTFADYKDILYSGSNDTT
SVSKETPSSSNNNNIVVLTSGSTEEKEKMKQLQAKIQEHINSVSTPPPTPGPQNNDEQRK
TWWEANGEHIWNAMVCALTYKEDTDSGPDGKTTLKRNDDVYEKIFGKPPNNDNPQNPNNK
LTPVTTGTYTTRYQYNTVTLKDESSDAKTNDPINNPKLKDFVKLPPFFRWLHEWGSDFCG
TRKRMLEKIKYECRNIERGGHEYCGGDGHYCKTSELKHHKMFADLDCRPCYEQCRKYRKW
IDIKFVEFHKQENTYKVEHDKLTNGDNYSGGGDNNCCEQIKKHSSAANFLEALKHCKDGQ
NNNDQNNIIDFKKPETTFGPLEYCKTCPIYGVKCNSGGRGGRTCTNIDESKYRKGKSING
QNDTNPKEIKVLLLGRKGKDNNNDKKLEEVNNACNNTGLLEDTCVQNWTCQKKSDEVHEC
NLNGAAESAKYVDSKYFENKISFKILFQSWLIDFIEHYNKSKERITRCTNDANSCKQICN
NKCDYVKQWLDVKEGEWEKIKNYYNDNFKDDKETIPSRVKSFLEQGPFEKDYQKAQEVVD
NACDKEKLWGCTGPNECKQTDKRMYDDFITNLIDKLKKKATSCQKQHSGDTQPNCVQSSP
LPDDEEPEDLLLEENENQVVQPKICPQLPKPQAEEKGDCVPAKTTPKETESTTPKKPAAE
SEEQIPVPKREEEEAPVPSPKQSPRPKSTNKRRIQPRNVLEHPAVIPALVTSTLAWSVGI
GFAAFTYFFLK
Download sequence
Identical sequences W7FKJ7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]