SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7FNI5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7FNI5
Domain Number 1 Region: 61-265
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.92e-47
Family Duffy binding domain 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W7FNI5
Sequence length 265
Comment (tr|W7FNI5|W7FNI5_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:EUT74974.1} KW=Complete proteome OX=478859 OS=Plasmodium falciparum Santa Lucia. GN=PFAG_06013 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MVPKPHGSAETTIDYSNIKDAKHLLDIIGKDVYDEVHKEDADYRKYLQGHLKNAIFEKDP
NDQQTPQDPCLLIHEYHTTVTSGYNNENPCKDRGEVRFSYTEGAECNKRKIKCKKDSDNE
CGACAPFRRLHLCDHNLENISDFDHINNDTLLADVCLAAKFEGETLTTQHGQHQLTYPDS
HYEICTELARSFADIGDIIRGKDLYRRDNKKDKLENNLKTIFKQIHEKLTDLRANDHYKD
ENGGNFFKLREDWWTANRATVWEAI
Download sequence
Identical sequences W7FNI5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]