SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7FTF5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7FTF5
Domain Number 1 Region: 1-149
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.4e-17
Family Duffy binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W7FTF5
Sequence length 501
Comment (tr|W7FTF5|W7FTF5_PLAF8) Uncharacterized protein {ECO:0000313|EMBL:EUR79045.1} KW=Complete proteome OX=57266 OS=Plasmodium falciparum (isolate 7G8). GN=PFBG_00534 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MLCQYNGDDKKEHCNEYEEIDKTPQFLRWLEEWARKYCTEKSTRAREINETCEDDIINKI
HTYSIDNIPDEPCKTALTKYRNWYNNNYLHWENLKKKYESNKKNEKEQTTNGAHLSPSTT
TSFYKDDDAEAYVKRKCKECTCNYKDLQEEYKRITEGNNEAIDAVPNIIYKGSHYGFQAA
TNVISGLNRTISSFTRDQGQSRDSNSPDQTTQRDDGDEPPLPDGPPGKVPATDQITNALL
GSAIPLGVGIAFASLAYLLLKVKPKITSTRTNLFRVIDIPQNDYGIPHKTSINRYVPYSS
NLYKEKTYIYIEGEETDDYSYVRVISSSDITSSSEGEYEEMDINDIYPYKSPTYKTLIEV
VLKPSIKNEEAHNTEDAQDILIENMEDTNDTPTNKLTDEEWNKLRNDFISQYLKDLPNGM
DYQLPNEYTVDDNIYMDIEPNILHDSMDEKPFITQIQDRDLHNGKQITYDINWNIQKRNE
KLLVILQMIRNIFQIMIYILE
Download sequence
Identical sequences A0A024VCA2 W7FTF5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]