SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7FUF2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7FUF2
Domain Number 1 Region: 1-172
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.31e-20
Family Duffy binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W7FUF2
Sequence length 321
Comment (tr|W7FUF2|W7FUF2_PLAF8) Uncharacterized protein {ECO:0000313|EMBL:EUR80897.1} KW=Complete proteome OX=57266 OS=Plasmodium falciparum (isolate 7G8). GN=PFBG_00263 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MFHTYSDFRDLCLGKDIGNDVGNGKTNIDRIFSKNNQTIEPEIWWKTIEKDIGEAMFCVL
KSVRNELTKNITYKYKNVIFNGNITTLTDFSTKSKFLQWLMEWARKYCSEKIKKNVKCQM
SLNEYKNWFNNSHLEWEKLKDEKKLYKQQSSYKYTEETAEDYVKKRCLECNCNYEDLKTV
HEIKHNKIILTFVSGPSTVDGEQQPQDPSVVPRAGEDHESSGSPGSQNNYSSFSSLYNML
TYGIPIRIGFLLGSAAFLFFYLKIAKIYMYIYGCYIYKKPKLRPTKLFRVIDIPQNDYNM
PTARSPNRYVPYESGRYVGKT
Download sequence
Identical sequences W7FUF2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]