SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7FVB8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7FVB8
Domain Number 1 Region: 1282-1617,1649-1668
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.02e-84
Family Duffy binding domain 0.00014
Further Details:      
 
Domain Number 2 Region: 2131-2333,2361-2479,2509-2527
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.14e-77
Family Duffy binding domain 0.00016
Further Details:      
 
Domain Number 3 Region: 63-466
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.58e-77
Family Duffy binding domain 0.00028
Further Details:      
 
Domain Number 4 Region: 1675-2006,2038-2057
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.84e-76
Family Duffy binding domain 0.00046
Further Details:      
 
Domain Number 5 Region: 782-1124,1176-1194
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.68e-76
Family Duffy binding domain 0.0001
Further Details:      
 
Domain Number 6 Region: 2591-2641,2675-2743,2778-2871,2932-2981,3004-3110
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.19e-67
Family Duffy binding domain 0.00065
Further Details:      
 
Domain Number 7 Region: 3096-3317
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.23e-41
Family Duffy binding domain 0.0035
Further Details:      
 
Domain Number 8 Region: 459-652
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.35e-27
Family Duffy binding domain 0.0026
Further Details:      
 
Weak hits

Sequence:  W7FVB8
Domain Number - Region: 3421-3452
Classification Level Classification E-value
Superfamily ARM repeat 0.0328
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W7FVB8
Sequence length 3918
Comment (tr|W7FVB8|W7FVB8_PLAF8) Uncharacterized protein {ECO:0000313|EMBL:EUR82664.1} KW=Complete proteome OX=57266 OS=Plasmodium falciparum (isolate 7G8). GN=PFBG_00009 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MGGNSSKGAPTYYTNESEKSARNVLENFAKDIKGKASNDAKKKGISLKGYLRQAKFYHDF
SKLYPNYRSPCDLNFWFHTNVWKRTPRERDPCYRRQPKNNPNLEGAVCTNSKIKGNENKI
IDIGACAPYRRRNICDYNLEHLNERNVLNTHDLLGNVLVMAKREGESIVNSQANNGTLNV
CTALARSFADIGDIVRGTDLFLGGPSQEKKKLEENLKKIFENIKNKNTKLSTLTLEKVRE
YWWALNRNDVWKALTCSAPYEAQYFIKSSDKKHSFSSEYCGHYKNGDPLTNLDYVPQFLR
WFEEWSEEFCRLKKMKFKLAKGACRNDEQKLYCSHNGYDCTKPIEKRSSCSRESKCTDCL
NKCIPYEYWLEKQQNEFKIQKEKYENEIKTYESDNDISNSNINNEYYEDFYKKLMETQYK
TVEDFLKLLNEGKYCKGVLEGGKDIDFTMTGDKDAFYRSDYCQVCPDCVVKCDGKTCAED
TKDNNCRSKIIEDILRSEQTTEIDVLYSGNGEGVITEKLKDFCSNPNNDKGKNYKKWKCY
NKNNDYNNCEMISSLYEDKNKPNVMLSVECFHSWAKNLLIDTIRWEHQLKNCINNTNVTD
CKSKCNSNCECYEKWIKEKEKEWQKVKNVIGNKDETSHNYYDKLKDVFDRFLFPVRGALE
EDEKVKWDQFTEDLKKKIDSSKKSAGTGNSQDAIEFLLDHLKDNASICKDNNTNEGCDPS
VDPTQNPCAKPHGKKHATVKQIAQYYKRKAHVQLEERGGRRALKGDATRGTYNLGGQGNT
LNGDICKITKNHTNDSRPNGERCTGKDKVKNGFRLKIGTPWTKIVQKKKKKSYKEVYLPP
RRQHMCTSNLEYLETKDKPLNGAGNGGVDIVNHSFLGDVLLSAKFEADFIKKKYKYANTP
ESFKDNATICQAIRYIFADIGDIIKGTDLWEANPGEKNTQRNLQRIFGKIKEELPKDIKG
KYTGTKHLKLRSDWWEANRAKVWEAMKCKTNGVDITCDSDHTPLDDYIPQRLRWMTEWAE
WFCKMQSQEYEKLKVCEKCMDNGKCTQGDVDCGKCKPACENYKKFIKKWQPQWDKIRAKY
KILYEHARVDIAANGGLNTSTAINDNEDKPVIEFLFELYKANGGKIGNPAVARATVNGIS
TDDTTPTVYSTPEGYIHQELPNVGCVSQKFFCNTNGNEDKYVFREKPKDHDEACGCNERN
PKPPAPKPLPTPNPCVNGGDNTGVGKITSVKQVAEEMQKEVHEGMLERSVKEGDKGKSGN
SCLVGNIKEAKFGKAAKSSDLDKGKICDLDEHKHTNAENSRGYRYEGPCTGKNQGRFNIG
TEWSYKNDQNKKTHPEAYMPPRREHMCTSNLEHLDIRSKGLTGTNAGHSLLGDVLLAAKY
EAENIKKLYQQNEGKKGLNDENDKATVCRAMKYSFADIGDIIRGKDLWDLPDFKKLEGYL
VTIFEKIKDELKSKLNGKYNSDNDGNKYINLRKDWWEANRDQIWEAMKCKTTNGEFPCSN
KEPTPIDDYIPQRLRWMTEWAEWYCKEQSRLYGELVEKCNGCRSGICEKECEDCRKKCKE
YEEKIKPWREQWEKIKDKYKTLYDKATKTGEPITSGDSKDEKDVVDFFQKLHEKNSDNTI
YATAAGYVHQELTKLDCNIQNVFCQKSDSDNKNYAFEPYPYDYKDKCNCKNDNPAKEKKK
EYDDVCETVKEHIGNNNGTQAIEHCKPKTEGSYPGWNCTDKIKQEEKGACMPPRRIKLCV
INLQHFNGTSKNDLREAFIKCAAAETFWLWHKYKEDTQKEKATHTADNDLNKGIIPDDFK
RQMFYTFGDYRDLCLGKDMGSDVIQANQKIYAYFSKNTDPSNTKWWDENGAHIWEGMLCA
LSHASGNISNVETIKNNNTYANVKFSGDKTTTLEEFAKRPQFLRWMTEWSEHFCKKQSQE
YNDLVNACQNCMSDKTCKQCSACTRKCKAYTKFVKEWEKDWETQRNKYSELYDKATQNGS
SSPKASKDQDQHVIDYFKTLNSNGTTYSTAGKYVEKEGYIKDCHNSKQNNFDKNSSTGNN
DNYAFKEYPHDHKTKCNCPETPPPLPPPPPPPRPPSGPPGDSGHDQRGRAEPGEDGVRPP
VPVPQPAQEEGSTPKEEEETATEKEVPKGPPATPKDDVNVCEIVDGILNGKNENTTVGLC
KKKDFGGKSYPDWQCDENSKLVTGNGECMPPRRIKLCLYFLAHQKEKRNLNKKEDLRKAF
IKCAAAETFFSWYYFKKINDKANELDGNLKKGQIPPEFLRSMFYTFGDYKDICLDTDISA
KTENGDITKAKSNIDRIIPKKSAKNPDEERKIWWDEIKNDVWKGMLCGLSHAVSNNDKAT
VQKTLTTKYPYHTIKFSGSNPPTLEEFAQRPQFLRWMTEWGEDFCKKRKEQVDILKGQCT
KCDVSTDGSCERDVDGCKKCREACKKYQEWLEKWRENYDKQKQRYTQVKETLPYNNDKDV
TISTHAYEYLSKKLTNIPCTNGITSANCEYKCMEGTSKQPKAKLPNGSTDDMPASLDDEP
KEVSGKCTCPPTPPKSKPTGGGGVARSLPPADRKNDLPDSEEEDDADDEDKDEDVETAAK
RPPQKEAEAPVETKKDDNVEKVCDIVKTALGGNLDEACNQKYSGNNSRLGWKCVTPSGNN
TTTSGDQKATDSESERPPRQRRNADPAKASGTNQGSICVPPRRRKLYIGKIKKWAEENSA
LSSETPQGGTSSAGGKETPSDKLRTAFIESAAIETFFAWHKFKKDKEKKKPQDGAGAAAL
AQDVSPEVDPQKELQESGKIPEDFLRLMFYTLGDYRDICVGNTDVVIKGSSGDKEMQERE
SKIKDAINNYFSNNGNKQPPSGKPQDKRKTWWDANVESIWNAMVCALTYKENGAKGKPPQ
QDKQVKEKLWDDNTKKPKKNAGPESNIDYTYENVVLKEDKNSVPKSNDPLNNPKLTEFVV
RPTYFRYLEEWGQNFCKERKKRLEKIEVECTKDGDGKTKKCSGDGLNCIETVPKNEEIFN
DFFCSTCAIHCRSYRKWIERKKDEFTKQGNAYNEQKKYKTESESAKSKPDKISDSEFLQN
LKKHGSIDLFLQKLGPCKNENGEDKKGDLYINFGDKDKAFKHTDYCDPCSQFKIKCENGK
CTSGGINEKCDGKMDITAEDIKKINDSNNVFMLVSDESTAGFPQDLNDCDGADIFKGIRK
DEWKCRNVCGVDICTLEKINNGKDEKYIIMKEFLKRWLEFFFEDYNRIKHKISHCIKNGK
ESKCICGCKKKCDCVEKWIEKKQEEWQKINSTYLKKYKPVDDGSNNLKSFLEQGIFESDK
KKAIKPCDSLTKFESFCGLNGTESSKKSKDGKKTDIVECLLHKLEKEATSCPGKRSGQNP
ETECQESPSVGDDDDEPMEGENPVTQPNICPAQPPSEPVEAEETCEESPRQTDVKKEEEE
KEEEKDKGDEEEEDEEEEEEEEEDDEEEEESDSDTYHDSYSETEEEDQNEDEAVPESLSH
SEPQPKGLPREFPSTQLKNAMLFSTILWMVGIGFAAFTYFFLKKKPKSPVDLIRVLDVHK
GDYEMPTLKSKNRYIPYRSGQYKGKTYIYMEGDSGDDDKYMFLSDTTDITSSESEYEEMD
INDIYVPDSPKYKTLIEVVLEPSKRDTPSSDTPMNKFTDEEWNELKRDFISQYIQSESLD
VPQYDVLKELPMNIGGNVLDDGINEKPFITSIHDRDLYSGEEYSYNIHMSTNTNNDIPIS
GTKDTYSGIDLINDSLSGEPIDIYDEVLKRKENELFGTNYKKNTSNNSVAKNTNNDPIMN
QLDLLHKWLDRHRDMCEKWKSKEDILHKLNEQWNKDNNSGDIPNDNKMLNTDVSIQIDMD
DGKPKKEFINMDTILDDMEDDIYYDVNDENPSVNDIPMDHNKVDVDVPKKVHVEMKILNN
TSNGSLEQEFPISDVWNI
Download sequence
Identical sequences W7FVB8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]