SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7FVN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7FVN6
Domain Number 1 Region: 61-340,370-483
Classification Level Classification E-value
Superfamily Duffy binding domain-like 8.89e-82
Family Duffy binding domain 0.00025
Further Details:      
 
Domain Number 2 Region: 835-928,964-986,1021-1122,1181-1230,1253-1353
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.35e-80
Family Duffy binding domain 0.0013
Further Details:      
 
Domain Number 3 Region: 1719-2073
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.09e-63
Family Duffy binding domain 0.0000751
Further Details:      
 
Domain Number 4 Region: 2101-2397
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.27e-61
Family Duffy binding domain 0.0001
Further Details:      
 
Domain Number 5 Region: 515-675,711-731
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.96e-29
Family Duffy binding domain 0.0054
Further Details:      
 
Domain Number 6 Region: 1370-1574
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.42e-19
Family Duffy binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W7FVN6
Sequence length 2790
Comment (tr|W7FVN6|W7FVN6_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:EUT66985.1} KW=Complete proteome OX=478859 OS=Plasmodium falciparum Santa Lucia. GN=PFAG_06117 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MGPQLLAAPDYSKATDAKDFLDQIGQIVHTKVHGDAQKYYAELHGDLSKATFRANDGRNK
VPAPQNACQLHHTVHTNVTVGYDKENPCLNRSNIRFSDVRGGECADSKIKGNKGSNGGAC
APYRRLHLCDYNLENISDFDNINNHTLLVDVCLAAKYEGQSISGQHGKYHTHSSGSTICT
VLARSFADIGDIIRGKDLYIRNKREKRRLEDNLKKIFQQIHDDVTKTSDKNGKALKTRYG
SDAPDFLKLREDWWDANREKVWKAITCGAGGGKYFRNTCVSGKDRTVTRENCQCIGGTVP
TYFDYVPQYLRWFEEWAEDFCTKRKKQLENAKKFCRGDEGKGEVKYCDLNRYDCTKTVIG
EKKLVKGDDCYNCSVTCNPFVPWIDNQKEEFLKQREKYTNEISGGKSRKKRSINGDKYKG
YDEEFYNILKREYRDVKKFLDLLSKETACESQPYDEGRTIGINFKNREPIDIFSHTEYCQ
ACPWCGVKEQKVNGRWKAKNYGECAKEVTKEYKKDNITDIPVLTPDTKKGDMIKKYGKFC
KDSNSQIKKWECYYDENIENSKENNNCIEGEWEKFKEGKTFRSYYFFFWIWVTEMLIDSI
DWRTQLSKCINNESKPCKNGCKNNCDCYKLWVKEKKKEWEQIKKHFRKQKDMKKGIEQDI
DPIIFLENVLDIDELFQNIKYTYGYVKEIDLINKMLKEDGTAESIGDVVNEENTPIDKLL
KHEAQDANRCKNCEDTAPKQAKENVGRSADHGEDHPDDNADTVVSEEEEEEEDEVEEEEE
ENEEEEEENVHDGEAEAEDNTHAEPVDKENVDGAEVETPEKTTEDTGKGSEPVSPPLPPV
NVCETVAKALEDTGSLQKACSTKYGSKAPTSWKCIGDSTTKPVSETARSSGEPTGGKDGA
TGGSICIPPRRRKLYVGKLEQWANSGNTGESKSLETTDTQTQSDTKTPSEVQTPQGQTPS
QSGEKLRDAFIQSAAVETFFLWDRYKKENTKKPDATQGGEGLALLQGETPQEDPQKQLNS
GTIPEEFKRQMFYTLGDYRDICIDVEDDVADALEKSVHNNRSGEKSNNITMKQISEKIKT
ILNSDNNKPSGVQNSVKDPKDWWDKNVESIWNGMICALTYKDSGAIGGTPQKIENPEKLW
DEDKKEPKETRYQYKTVVLKDESSGTGGTKGQTESSSSSDTPLLSDFVKRPTYFRYLEEW
GQNFCKERKKRLEEVRKGCRQKASGGDTYCGGDGHDCTDPDNQHNDMFADLYCPDCYEQC
RKYRKWIDIKFEEFHKQKDKYKGEHDKLKANHNGDDKNIYEKLKDYTTADKFLESLKHCS
NDVSDSDEDKLNKINFQKPLETFNPSTYCKACPVYGVQKNRGTYSAINESKYMSKNSISG
ENKNDKDPTDIEVLVLGRKGKDNNNDKKLEEVNNACKNTGLLEDTCVQNWTCQKKKNGIH
ECTIKNADKSDKSFHSKYFENKISFKILFQSWLIDFIEHYNKSKERITRCTNDANSCKQI
CNNKCDYVKQWLEIKGNEWQSIKEYYEEYFKDKSELIPSRVKSFFQQRPFENYYKKAQEV
VEDPNKRDELWGCTDRDGCEQEENKEKYGDFITNLIKELKEKIGECKKQHQNSGETQNNC
VQPSPLEEPDEPLDDYYIQQPKICPPPMTCVERAAKQLRSQSQSKIPNNSKLKANGIELS
SICNKIKRDNDKMQDSSCDFDKTYKTSIESLNNPCYNNGKKRLNIEESWKCINTKKIGKS
LCIPPRREGICIDDLKRVTSYSINDSSDLLKLIQKLAKTEADDIITKILQNNACHDFQIC
DALKYSFADLADIIRGREFWQRGTDYERIKSRLRRIFENIYNIMDPEEKSKYKDRVNYYE
LRSDWWDANRKHIWNAMTCNAPDAAKFLKKNPNDTSGSSSAKGIMTRHPKCGYDKDPPDY
DYIPQPFRWMQEWSESFCKLLNEQIKKFETECADCKNNGVSCKDDKTGEKCEKCKKQCEK
YKQIVHEWQNQFGKYKETYKEIYNNEDIKINSSEYFKNFLQKLKDDCHDLTDVDEYLDKS
NNCINFTFRKGNKKHEKYAFKETPNDYVNACNCDPTDILHECPFKNGNQDACKSISTENI
CKKKNFDNDLDDWNSGDIPESTSKNNGVLVPPRRRQLCVKNMTTMLSSIVKKNDFKIKLL
QSAYNEGYFLGKTYAKDKQIILQAMKYSFADYGDIVKGTDVMDNLKKLHEILKSILKTEN
GNNQISHDRKNWWTQNKTHVWHAMLCGYKKAGGTIGPNDCNIPSEENTPQFLRWFQEWGE
NFCTKRKELYDEVQNKCVSAECNTSNGSVGKPECTKACEKYKNYVITKIIEYNGQKGKYD
IEFKDETNDKNIFDFFKKKCFNNNCNCLSENFKDETNWENPYESITDVALKDKCDCKKIK
PVEPPPAPLPPTPSDESFDPTILQTTIPFGVALALGSIAFLFLKKKTKSSVGNLFQILQI
PKSDYDIPTPKSSNRYIPYASDKYKGKTYIYMEGDSDEDKYAFIKITDNEWNTLKDEFIS
NMLQSEPKDVPNNYTSGDIPLNTQPNTLYFDNNQEKPFIMSIHDRNLYSGEEYSYNVNMV
NSMNDIPISGKNDVYSGIDLINDSLNSNNVDIYDEVLKRKENELFGTNHVKQTSIHSVAK
PARDDPIHNQLELFHTWLDRHRDMCEKWENHHERLAKLKEEWENDTSTSGNTHPSDSNKT
LNTDVSIQIHMDNPKPINEFSNMDTILEDLEKYNEPYYDVQDDIYYDVHDHDTSTVDSNN
MDVPSKVQIEMDINTKLVKEKYPIADVWDI
Download sequence
Identical sequences W7FVN6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]